Metagenome Family F006851

Basic Information
Family ID	F006851
Family Type	Metagenome
Number of Sequences	363
Average Sequence Length	47 residues
Representative Sequence	MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLACGGEQWLLR
Number of Associated Samples	282
Number of Associated Scaffolds	363

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	40.22 %
% of genes near scaffold ends (potentially truncated)	99.45 %
% of genes from short scaffolds (< 2000 bps)	93.66 %
Associated GOLD sequencing projects	265
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Most Common Taxonomy
Group	Bacteria (69.421 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.540 % of family members)
Environment Ontology (ENVO)	Unclassified (31.956 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (37.190 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 363 Family Scaffolds
PF00072	Response_reg	92.01
PF00585	Thr_dehydrat_C	6.61
PF13090	PP_kinase_C	0.55
PF08340	DUF1732	0.28
PF02897	Peptidase_S9_N	0.28

COG ID	Name	Functional Category	% Frequency in 363 Family Scaffolds
COG1171	Threonine deaminase	Amino acid transport and metabolism [E]	6.61
COG1505	Prolyl endopeptidase PreP, S9A serine peptidase family	Amino acid transport and metabolism [E]	0.28
COG1561	Endoribonuclease YloC, YicC family	Translation, ribosomal structure and biogenesis [J]	0.28
COG1770	Protease II	Amino acid transport and metabolism [E]	0.28

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.28 %
Unclassified	root	N/A	26.72 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.28 %
Unclassified	root	N/A	26.72 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	69.42 %
Unclassified	root	N/A	26.72 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.86 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	59.78 %
Unclassified	root	N/A	26.72 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.28 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	55.65 %
Unclassified	root	N/A	26.72 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.86 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.28 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4.68 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	4.41 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.86 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.28 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.28 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	0.28 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.86 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	1.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Steroidobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae	0.28 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	0.28 %
Sulfuricellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae	0.83 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	3.58 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.10 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.28 %
Steroidobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter	0.28 %
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	0.28 %
Dechloromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella	0.83 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	3.58 %
unclassified Aromatoleum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum	0.28 %
unclassified Azospira	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	3.58 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	1.93 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	1.93 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	1.93 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	1.93 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	1.93 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	1.93 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	1.93 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	1.93 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1.93 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1.93 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.72 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1.93 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1.65 %
Azospira sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	0.28 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	0.28 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.28 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	0.28 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.28 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.28 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.55 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.55 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090009\|LWAnN_GIDYKCY01CNZBG	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	502	Open in IMG/M
2124908043\|A2_c1_ConsensusfromContig39445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	767	Open in IMG/M
3300000312\|WSSedB2BaDRAFT_1021113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	516	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1001886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4556	Open in IMG/M
3300003861\|Ga0031654_10132735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	702	Open in IMG/M
3300004011\|Ga0055460_10144487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	710	Open in IMG/M
3300004014\|Ga0055456_10295542	Not Available	574	Open in IMG/M
3300004047\|Ga0055499_10087387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	560	Open in IMG/M
3300004157\|Ga0062590_101257979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	726	Open in IMG/M
3300004241\|Ga0066604_10385116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	562	Open in IMG/M
3300004782\|Ga0062382_10022443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2089	Open in IMG/M
3300005177\|Ga0066690_10960510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	541	Open in IMG/M
3300005180\|Ga0066685_10349030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1027	Open in IMG/M
3300005181\|Ga0066678_10147969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1467	Open in IMG/M
3300005181\|Ga0066678_10681405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	685	Open in IMG/M
3300005184\|Ga0066671_10852488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	580	Open in IMG/M
3300005186\|Ga0066676_11013792	Not Available	551	Open in IMG/M
3300005187\|Ga0066675_10084603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2056	Open in IMG/M
3300005290\|Ga0065712_10635223	Not Available	574	Open in IMG/M
3300005335\|Ga0070666_10133651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1725	Open in IMG/M
3300005343\|Ga0070687_100458134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	850	Open in IMG/M
3300005343\|Ga0070687_100489058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	826	Open in IMG/M
3300005343\|Ga0070687_100533224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	796	Open in IMG/M
3300005347\|Ga0070668_102209347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300005353\|Ga0070669_100977265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	726	Open in IMG/M
3300005354\|Ga0070675_101556742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	610	Open in IMG/M
3300005356\|Ga0070674_100359449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1178	Open in IMG/M
3300005367\|Ga0070667_101044300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	763	Open in IMG/M
3300005436\|Ga0070713_100024012	Not Available	4741	Open in IMG/M
3300005439\|Ga0070711_100681794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	864	Open in IMG/M
3300005441\|Ga0070700_101331111	Not Available	605	Open in IMG/M
3300005445\|Ga0070708_100392811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1308	Open in IMG/M
3300005450\|Ga0066682_10653087	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300005455\|Ga0070663_101913351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	533	Open in IMG/M
3300005458\|Ga0070681_11636662	Not Available	569	Open in IMG/M
3300005471\|Ga0070698_102196214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	505	Open in IMG/M
3300005481\|Ga0074210_113469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	863	Open in IMG/M
3300005487\|Ga0074211_112403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	840	Open in IMG/M
3300005530\|Ga0070679_100090444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3049	Open in IMG/M
3300005543\|Ga0070672_102054317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	515	Open in IMG/M
3300005544\|Ga0070686_101917065	Not Available	506	Open in IMG/M
3300005547\|Ga0070693_100151671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1469	Open in IMG/M
3300005547\|Ga0070693_100623985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	781	Open in IMG/M
3300005547\|Ga0070693_101481586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	530	Open in IMG/M
3300005556\|Ga0066707_10899198	Not Available	543	Open in IMG/M
3300005563\|Ga0068855_100469828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1370	Open in IMG/M
3300005577\|Ga0068857_102438203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	514	Open in IMG/M
3300005598\|Ga0066706_10621199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	857	Open in IMG/M
3300005616\|Ga0068852_101481244	Not Available	701	Open in IMG/M
3300005616\|Ga0068852_102079124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	590	Open in IMG/M
3300005618\|Ga0068864_102154977	Not Available	564	Open in IMG/M
3300005618\|Ga0068864_102289165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	547	Open in IMG/M
3300005833\|Ga0074472_10488391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	810	Open in IMG/M
3300005841\|Ga0068863_100412272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1323	Open in IMG/M
3300005956\|Ga0073920_1020023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	833	Open in IMG/M
3300006032\|Ga0066696_10554328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	750	Open in IMG/M
3300006046\|Ga0066652_101648174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	587	Open in IMG/M
3300006050\|Ga0075028_100068154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1752	Open in IMG/M
3300006050\|Ga0075028_100542189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	684	Open in IMG/M
3300006224\|Ga0079037_102617990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	502	Open in IMG/M
3300006237\|Ga0097621_101332552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	678	Open in IMG/M
3300006358\|Ga0068871_100919137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	812	Open in IMG/M
3300006358\|Ga0068871_101394230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	661	Open in IMG/M
3300006642\|Ga0075521_10032194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2213	Open in IMG/M
3300006755\|Ga0079222_10009058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3526	Open in IMG/M
3300006755\|Ga0079222_11541635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	626	Open in IMG/M
3300006797\|Ga0066659_11895090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	506	Open in IMG/M
3300006800\|Ga0066660_10614764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	907	Open in IMG/M
3300006806\|Ga0079220_11229607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	621	Open in IMG/M
3300006846\|Ga0075430_101510922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	552	Open in IMG/M
3300006954\|Ga0079219_10070860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1594	Open in IMG/M
3300006954\|Ga0079219_10210216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp.	1114	Open in IMG/M
3300007076\|Ga0075435_100219873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1613	Open in IMG/M
3300007076\|Ga0075435_100403338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1176	Open in IMG/M
3300009012\|Ga0066710_103336217	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300009090\|Ga0099827_10289590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1384	Open in IMG/M
3300009098\|Ga0105245_10523948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1204	Open in IMG/M
3300009098\|Ga0105245_11403295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	748	Open in IMG/M
3300009111\|Ga0115026_11675211	Not Available	535	Open in IMG/M
3300009131\|Ga0115027_11046123	Not Available	643	Open in IMG/M
3300009148\|Ga0105243_10738150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	964	Open in IMG/M
3300009156\|Ga0111538_11781901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	775	Open in IMG/M
3300009162\|Ga0075423_11723673	Not Available	675	Open in IMG/M
3300009162\|Ga0075423_12288126	Not Available	588	Open in IMG/M
3300009167\|Ga0113563_11155910	Not Available	899	Open in IMG/M
3300009167\|Ga0113563_11546957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	783	Open in IMG/M
3300009174\|Ga0105241_10555523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1031	Open in IMG/M
3300009174\|Ga0105241_11002522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	781	Open in IMG/M
3300009174\|Ga0105241_11589932	Not Available	632	Open in IMG/M
3300009179\|Ga0115028_11475933	All Organisms → cellular organisms → Bacteria → Proteobacteria	576	Open in IMG/M
3300009545\|Ga0105237_11671287	Not Available	644	Open in IMG/M
3300009551\|Ga0105238_11148519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	800	Open in IMG/M
3300009667\|Ga0116147_1278729	Not Available	635	Open in IMG/M
3300009838\|Ga0116153_10133826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1031	Open in IMG/M
3300009840\|Ga0126313_11593603	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300010343\|Ga0074044_10730406	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300010364\|Ga0134066_10311447	Not Available	569	Open in IMG/M
3300010366\|Ga0126379_10886788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	994	Open in IMG/M
3300010366\|Ga0126379_10894747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	990	Open in IMG/M
3300010366\|Ga0126379_11860130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	706	Open in IMG/M
3300010366\|Ga0126379_12938239	Not Available	570	Open in IMG/M
3300010396\|Ga0134126_11440505	Not Available	760	Open in IMG/M
3300010397\|Ga0134124_10887269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	897	Open in IMG/M
3300010398\|Ga0126383_11714835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	717	Open in IMG/M
3300010398\|Ga0126383_12370324	Not Available	616	Open in IMG/M
3300010400\|Ga0134122_12749396	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300010401\|Ga0134121_12271109	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300011269\|Ga0137392_10185196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1697	Open in IMG/M
3300011269\|Ga0137392_11447404	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300011445\|Ga0137427_10033439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2021	Open in IMG/M
3300012044\|Ga0136636_10251337	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300012046\|Ga0136634_10503563	Not Available	516	Open in IMG/M
3300012189\|Ga0137388_10679249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	956	Open in IMG/M
3300012198\|Ga0137364_10546561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	872	Open in IMG/M
3300012210\|Ga0137378_10201321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1853	Open in IMG/M
3300012285\|Ga0137370_10207837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1150	Open in IMG/M
3300012469\|Ga0150984_117803777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1039	Open in IMG/M
3300012469\|Ga0150984_120003136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	1155	Open in IMG/M
3300012509\|Ga0157334_1015846	Not Available	777	Open in IMG/M
3300012511\|Ga0157332_1062007	Not Available	563	Open in IMG/M
3300012532\|Ga0137373_10637402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	800	Open in IMG/M
3300012898\|Ga0157293_10051006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	920	Open in IMG/M
3300012906\|Ga0157295_10382276	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300012916\|Ga0157310_10192435	Not Available	736	Open in IMG/M
3300012916\|Ga0157310_10362661	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300012927\|Ga0137416_10814142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	826	Open in IMG/M
3300012930\|Ga0137407_11496430	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300012951\|Ga0164300_10564704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664	Open in IMG/M
3300012955\|Ga0164298_10503020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	810	Open in IMG/M
3300012958\|Ga0164299_10111064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1445	Open in IMG/M
3300012958\|Ga0164299_10372612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	907	Open in IMG/M
3300012958\|Ga0164299_10652421	Not Available	728	Open in IMG/M
3300012971\|Ga0126369_11130002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	873	Open in IMG/M
3300012971\|Ga0126369_11906569	Not Available	683	Open in IMG/M
3300012971\|Ga0126369_12942958	Not Available	558	Open in IMG/M
3300012971\|Ga0126369_13551665	Not Available	511	Open in IMG/M
3300013102\|Ga0157371_10286128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1191	Open in IMG/M
3300013104\|Ga0157370_10694912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	928	Open in IMG/M
3300013297\|Ga0157378_10196024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1908	Open in IMG/M
3300013306\|Ga0163162_11275469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	834	Open in IMG/M
3300013306\|Ga0163162_12697709	All Organisms → cellular organisms → Bacteria → Proteobacteria	572	Open in IMG/M
3300013307\|Ga0157372_11715612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	722	Open in IMG/M
3300013307\|Ga0157372_12278174	Not Available	622	Open in IMG/M
3300013503\|Ga0120127_10022475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1132	Open in IMG/M
3300013770\|Ga0120123_1171746	Not Available	519	Open in IMG/M
3300014313\|Ga0075347_1031413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1037	Open in IMG/M
3300014969\|Ga0157376_11543820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300015197\|Ga0167638_1031450	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1213	Open in IMG/M
3300015371\|Ga0132258_12856816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1201	Open in IMG/M
3300015371\|Ga0132258_13862918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1019	Open in IMG/M
3300015372\|Ga0132256_100442767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1406	Open in IMG/M
3300015373\|Ga0132257_100176339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2520	Open in IMG/M
3300015373\|Ga0132257_104081751	Not Available	531	Open in IMG/M
3300015374\|Ga0132255_100466844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1850	Open in IMG/M
3300015374\|Ga0132255_105492281	Not Available	536	Open in IMG/M
3300016319\|Ga0182033_11527391	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300016357\|Ga0182032_11683216	Not Available	553	Open in IMG/M
3300017792\|Ga0163161_11884861	Not Available	532	Open in IMG/M
3300017930\|Ga0187825_10263754	Not Available	634	Open in IMG/M
3300018027\|Ga0184605_10050158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1774	Open in IMG/M
3300018058\|Ga0187766_10251802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1130	Open in IMG/M
3300018058\|Ga0187766_10908214	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300018058\|Ga0187766_11206727	Not Available	548	Open in IMG/M
3300018075\|Ga0184632_10350724	Not Available	631	Open in IMG/M
3300018081\|Ga0184625_10545563	Not Available	577	Open in IMG/M
3300018429\|Ga0190272_11633899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	663	Open in IMG/M
3300018476\|Ga0190274_10440601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1280	Open in IMG/M
3300018482\|Ga0066669_11599865	Not Available	595	Open in IMG/M
3300018920\|Ga0190273_12054268	Not Available	531	Open in IMG/M
3300019879\|Ga0193723_1115611	Not Available	748	Open in IMG/M
3300019883\|Ga0193725_1124804	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300019890\|Ga0193728_1191193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	867	Open in IMG/M
3300020004\|Ga0193755_1048134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1396	Open in IMG/M
3300020059\|Ga0193745_1119505	Not Available	549	Open in IMG/M
3300021344\|Ga0193719_10106066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1221	Open in IMG/M
3300021432\|Ga0210384_11184821	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300021445\|Ga0182009_10025535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2301	Open in IMG/M
3300021445\|Ga0182009_10049875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1765	Open in IMG/M
3300021478\|Ga0210402_10255520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1618	Open in IMG/M
(restricted) 3300021518\|Ga0224722_1026597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2173	Open in IMG/M
3300022214\|Ga0224505_10148946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	904	Open in IMG/M
3300022534\|Ga0224452_1251110	Not Available	541	Open in IMG/M
3300022756\|Ga0222622_10246691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1208	Open in IMG/M
3300022756\|Ga0222622_11365091	All Organisms → cellular organisms → Bacteria → Proteobacteria	522	Open in IMG/M
3300022880\|Ga0247792_1148608	Not Available	507	Open in IMG/M
3300022901\|Ga0247788_1049883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	778	Open in IMG/M
3300023064\|Ga0247801_1094501	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300025315\|Ga0207697_10247547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	788	Open in IMG/M
3300025321\|Ga0207656_10112418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1260	Open in IMG/M
3300025461\|Ga0208851_1055656	Not Available	686	Open in IMG/M
3300025905\|Ga0207685_10777615	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	526	Open in IMG/M
3300025906\|Ga0207699_10218730	Not Available	1299	Open in IMG/M
3300025907\|Ga0207645_10046586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2769	Open in IMG/M
3300025908\|Ga0207643_10804429	Not Available	609	Open in IMG/M
3300025911\|Ga0207654_10561211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	812	Open in IMG/M
3300025912\|Ga0207707_10013735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7062	Open in IMG/M
3300025914\|Ga0207671_10795279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	750	Open in IMG/M
3300025915\|Ga0207693_10598473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	858	Open in IMG/M
3300025916\|Ga0207663_10412719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1035	Open in IMG/M
3300025916\|Ga0207663_10724285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	789	Open in IMG/M
3300025917\|Ga0207660_10473626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1014	Open in IMG/M
3300025917\|Ga0207660_11381209	Not Available	571	Open in IMG/M
3300025921\|Ga0207652_10554396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1033	Open in IMG/M
3300025923\|Ga0207681_10629630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	888	Open in IMG/M
3300025925\|Ga0207650_10276633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1366	Open in IMG/M
3300025927\|Ga0207687_11102004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	682	Open in IMG/M
3300025930\|Ga0207701_11026443	All Organisms → cellular organisms → Bacteria → Proteobacteria	686	Open in IMG/M
3300025930\|Ga0207701_11486630	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300025931\|Ga0207644_10563000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	944	Open in IMG/M
3300025931\|Ga0207644_11360669	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300025934\|Ga0207686_11676082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	526	Open in IMG/M
3300025936\|Ga0207670_11835004	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300025938\|Ga0207704_11193499	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300025940\|Ga0207691_10616474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	918	Open in IMG/M
3300025940\|Ga0207691_10649534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	891	Open in IMG/M
3300025940\|Ga0207691_11206610	Not Available	627	Open in IMG/M
3300025941\|Ga0207711_10013511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	6779	Open in IMG/M
3300025941\|Ga0207711_10463313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1180	Open in IMG/M
3300025942\|Ga0207689_11569696	Not Available	548	Open in IMG/M
3300025944\|Ga0207661_11561094	Not Available	604	Open in IMG/M
3300025945\|Ga0207679_10677179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	935	Open in IMG/M
3300025945\|Ga0207679_11478699	All Organisms → cellular organisms → Bacteria → Proteobacteria	623	Open in IMG/M
3300025981\|Ga0207640_10182176	All Organisms → cellular organisms → Bacteria	1576	Open in IMG/M
3300025981\|Ga0207640_11824059	Not Available	550	Open in IMG/M
3300025986\|Ga0207658_10549490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1033	Open in IMG/M
3300025986\|Ga0207658_10834261	Not Available	838	Open in IMG/M
3300026041\|Ga0207639_10340279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1337	Open in IMG/M
3300026041\|Ga0207639_12237866	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300026058\|Ga0208421_1021489	Not Available	589	Open in IMG/M
3300026067\|Ga0207678_11298993	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300026069\|Ga0208539_1009546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	879	Open in IMG/M
3300026078\|Ga0207702_12502291	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300026088\|Ga0207641_11991896	Not Available	582	Open in IMG/M
3300026095\|Ga0207676_10813172	Not Available	912	Open in IMG/M
3300026142\|Ga0207698_10454612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1237	Open in IMG/M
3300026142\|Ga0207698_11397770	Not Available	715	Open in IMG/M
3300026142\|Ga0207698_11770108	Not Available	633	Open in IMG/M
3300026215\|Ga0209849_1059519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	670	Open in IMG/M
3300026309\|Ga0209055_1293693	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300026374\|Ga0257146_1064770	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300026529\|Ga0209806_1197207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	706	Open in IMG/M
3300027548\|Ga0209523_1114416	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300027682\|Ga0209971_1040556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1120	Open in IMG/M
3300027829\|Ga0209773_10168941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	913	Open in IMG/M
3300027831\|Ga0209797_10217555	Not Available	809	Open in IMG/M
3300027840\|Ga0209683_10039099	Not Available	2050	Open in IMG/M
3300027885\|Ga0209450_10063073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2338	Open in IMG/M
3300027887\|Ga0208980_10327628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	887	Open in IMG/M
3300027897\|Ga0209254_10790766	Not Available	643	Open in IMG/M
3300027900\|Ga0209253_10637818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	777	Open in IMG/M
3300028379\|Ga0268266_10185935	All Organisms → cellular organisms → Bacteria	1894	Open in IMG/M
3300028379\|Ga0268266_10929936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	841	Open in IMG/M
3300028381\|Ga0268264_10349313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1407	Open in IMG/M
3300028381\|Ga0268264_11205616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	766	Open in IMG/M
3300028381\|Ga0268264_12146943	Not Available	567	Open in IMG/M
3300028587\|Ga0247828_10047558	Not Available	1842	Open in IMG/M
3300028589\|Ga0247818_10701875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	701	Open in IMG/M
3300028590\|Ga0247823_10510540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	906	Open in IMG/M
3300028596\|Ga0247821_10203248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1172	Open in IMG/M
3300028652\|Ga0302166_10080292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	712	Open in IMG/M
3300028652\|Ga0302166_10129651	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	577	Open in IMG/M
3300028679\|Ga0302169_10101810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300028804\|Ga0268298_10217738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1031	Open in IMG/M
3300028809\|Ga0247824_10925134	Not Available	547	Open in IMG/M
3300028861\|Ga0302259_1178125	Not Available	532	Open in IMG/M
3300028870\|Ga0302254_10287318	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300029923\|Ga0311347_10329111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	932	Open in IMG/M
3300029984\|Ga0311332_11220789	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300029989\|Ga0311365_11600065	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300029990\|Ga0311336_10090426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2415	Open in IMG/M
3300029990\|Ga0311336_10722148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	855	Open in IMG/M
3300030000\|Ga0311337_10139313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1959	Open in IMG/M
3300030000\|Ga0311337_11935587	Not Available	518	Open in IMG/M
3300030002\|Ga0311350_10014629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	6784	Open in IMG/M
3300030002\|Ga0311350_11168496	Not Available	686	Open in IMG/M
3300030002\|Ga0311350_11941362	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300030047\|Ga0302286_10462178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	642	Open in IMG/M
3300030052\|Ga0302217_10120374	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300030294\|Ga0311349_10276865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1583	Open in IMG/M
3300030294\|Ga0311349_10985820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	790	Open in IMG/M
3300030294\|Ga0311349_11454258	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	636	Open in IMG/M
3300030339\|Ga0311360_11230402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	588	Open in IMG/M
3300030838\|Ga0311335_10858471	Not Available	643	Open in IMG/M
3300030943\|Ga0311366_11545685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	568	Open in IMG/M
3300031170\|Ga0307498_10121087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	833	Open in IMG/M
3300031199\|Ga0307495_10234608	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300031232\|Ga0302323_100522331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1276	Open in IMG/M
3300031232\|Ga0302323_101006944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	925	Open in IMG/M
3300031521\|Ga0311364_10625452	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1085	Open in IMG/M
3300031521\|Ga0311364_10983691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	842	Open in IMG/M
3300031548\|Ga0307408_102511968	Not Available	501	Open in IMG/M
3300031716\|Ga0310813_12198135	Not Available	522	Open in IMG/M
3300031720\|Ga0307469_10856957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	838	Open in IMG/M
3300031720\|Ga0307469_11229625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	709	Open in IMG/M
3300031720\|Ga0307469_11645708	Not Available	618	Open in IMG/M
3300031722\|Ga0311351_10958334	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300031724\|Ga0318500_10061115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1630	Open in IMG/M
3300031726\|Ga0302321_100804086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1061	Open in IMG/M
3300031726\|Ga0302321_101662588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	738	Open in IMG/M
3300031731\|Ga0307405_10423395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1048	Open in IMG/M
3300031753\|Ga0307477_11018555	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300031795\|Ga0318557_10476227	Not Available	574	Open in IMG/M
3300031798\|Ga0318523_10506726	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300031820\|Ga0307473_10631960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	743	Open in IMG/M
3300031834\|Ga0315290_11122489	Not Available	656	Open in IMG/M
3300031834\|Ga0315290_11215048	Not Available	625	Open in IMG/M
3300031858\|Ga0310892_10081148	All Organisms → cellular organisms → Bacteria	1718	Open in IMG/M
3300031858\|Ga0310892_10228947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1134	Open in IMG/M
3300031873\|Ga0315297_10113745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2161	Open in IMG/M
3300031873\|Ga0315297_11014540	Not Available	686	Open in IMG/M
3300031890\|Ga0306925_10779768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	994	Open in IMG/M
3300031901\|Ga0307406_10001123	Not Available	14952	Open in IMG/M
3300031908\|Ga0310900_10034623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2833	Open in IMG/M
3300031918\|Ga0311367_11578343	Not Available	642	Open in IMG/M
3300031918\|Ga0311367_11748469	Not Available	605	Open in IMG/M
3300031938\|Ga0308175_100312675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1607	Open in IMG/M
3300031939\|Ga0308174_10852589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	767	Open in IMG/M
3300031939\|Ga0308174_11735333	Not Available	536	Open in IMG/M
3300031941\|Ga0310912_10918587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	673	Open in IMG/M
3300031942\|Ga0310916_10451328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1095	Open in IMG/M
3300031942\|Ga0310916_11759642	Not Available	500	Open in IMG/M
3300031996\|Ga0308176_12991208	Not Available	501	Open in IMG/M
3300031997\|Ga0315278_10950754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	859	Open in IMG/M
3300031997\|Ga0315278_11734597	Not Available	592	Open in IMG/M
3300032002\|Ga0307416_103308446	Not Available	539	Open in IMG/M
3300032003\|Ga0310897_10616343	Not Available	538	Open in IMG/M
3300032005\|Ga0307411_10346775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1209	Open in IMG/M
3300032008\|Ga0318562_10167219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1269	Open in IMG/M
3300032009\|Ga0318563_10609667	All Organisms → cellular organisms → Bacteria → Proteobacteria	588	Open in IMG/M
3300032064\|Ga0318510_10459870	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300032075\|Ga0310890_10141318	All Organisms → cellular organisms → Bacteria	1578	Open in IMG/M
3300032118\|Ga0315277_10687932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	987	Open in IMG/M
3300032126\|Ga0307415_100983356	Not Available	783	Open in IMG/M
3300032163\|Ga0315281_11241898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	742	Open in IMG/M
3300032164\|Ga0315283_11384626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	725	Open in IMG/M
3300032174\|Ga0307470_10224321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1221	Open in IMG/M
3300032174\|Ga0307470_11905531	Not Available	506	Open in IMG/M
3300032177\|Ga0315276_12006068	Not Available	590	Open in IMG/M
3300032205\|Ga0307472_102572460	Not Available	518	Open in IMG/M
3300032211\|Ga0310896_10815363	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300032256\|Ga0315271_11107682	Not Available	684	Open in IMG/M
3300032397\|Ga0315287_10155065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2649	Open in IMG/M
3300032397\|Ga0315287_10429870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella	1566	Open in IMG/M
3300032397\|Ga0315287_11805346	All Organisms → cellular organisms → Bacteria → Proteobacteria	680	Open in IMG/M
3300032397\|Ga0315287_12397099	Not Available	570	Open in IMG/M
3300032516\|Ga0315273_10285756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	2241	Open in IMG/M
3300032782\|Ga0335082_10885303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	756	Open in IMG/M
3300032782\|Ga0335082_11688926	Not Available	507	Open in IMG/M
3300032829\|Ga0335070_11176315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	704	Open in IMG/M
3300032954\|Ga0335083_10199421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1833	Open in IMG/M
3300033290\|Ga0318519_10161805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1257	Open in IMG/M
3300033412\|Ga0310810_10716596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	926	Open in IMG/M
3300033416\|Ga0316622_100904784	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1028	Open in IMG/M
3300033416\|Ga0316622_102355342	Not Available	615	Open in IMG/M
3300033433\|Ga0326726_10724549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	960	Open in IMG/M
3300033433\|Ga0326726_11150121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	755	Open in IMG/M
3300033482\|Ga0316627_100363410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	1223	Open in IMG/M
3300033483\|Ga0316629_10281222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1112	Open in IMG/M
3300033483\|Ga0316629_10825038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	714	Open in IMG/M
3300033488\|Ga0316621_10424623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	912	Open in IMG/M
3300034178\|Ga0364934_0366736	Not Available	545	Open in IMG/M
3300034197\|Ga0370508_0317514	Not Available	518	Open in IMG/M
3300034268\|Ga0372943_0756066	Not Available	643	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.45%
Host-Associated	Host-Associated	26.72%
Engineered	Engineered	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.58%
Plants	Host-Associated → Plants	26.72%
Aquatic	Environmental → Aquatic	14.88%
Wastewater	Engineered → Wastewater	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.98%
Freshwater	Environmental → Aquatic → Freshwater	10.47%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.92%
Peat	Environmental → Terrestrial → Peat	9.37%
Sediment	Environmental → Aquatic → Sediment	2.75%
Marine	Environmental → Aquatic → Marine	1.65%
Roots	Host-Associated → Plants → Roots	0.83%
Floodplain	Environmental → Terrestrial → Floodplain	0.28%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.28%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.26%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	9.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.82%
Loam	Environmental → Terrestrial → Soil → Loam	7.16%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.16%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.99%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.23%
Lake	Environmental → Aquatic → Freshwater → Lake	4.68%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.75%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.20%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.93%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.83%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.83%
Pond	Environmental → Aquatic → Freshwater → Pond	0.28%
Sediment	Environmental → Aquatic → Marine → Sediment	0.28%
Sand	Environmental → Terrestrial → Soil → Sand	0.28%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.28%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.28%
Ice	Environmental → Aquatic → Freshwater → Ice	0.55%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.60%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	9.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.16%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.16%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.99%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.89%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.68%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.13%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.75%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.48%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.93%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.65%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.38%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.83%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.28%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.28%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.28%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.28%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.28%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.28%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.28%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.28%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.28%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.55%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.55%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.55%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	8.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.61%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.86%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.31%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.75%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.75%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.20%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.20%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.38%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.38%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.10%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.10%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.83%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.83%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.83%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.83%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment	0.28%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.28%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.28%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.28%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.28%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.28%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.28%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.28%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.28%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.28%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.28%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.28%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.28%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.28%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.28%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.28%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.28%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.28%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.28%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.28%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.28%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.28%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.55%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.55%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.55%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.55%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.55%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.55%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.55%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.55%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.55%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090009	Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate	Environmental	Open in IMG/M
2124908043	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2	Environmental	Open in IMG/M
3300000312	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300003861	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR	Environmental	Open in IMG/M
3300004011	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2	Environmental	Open in IMG/M
3300004014	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2	Environmental	Open in IMG/M
3300004047	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004241	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11	Environmental	Open in IMG/M
3300004782	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005481	Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methylamine enrichment	Environmental	Open in IMG/M
3300005487	Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005956	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009667	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG	Engineered	Open in IMG/M
3300009838	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG	Engineered	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental	Open in IMG/M
3300012044	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06)	Environmental	Open in IMG/M
3300012046	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012509	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6	Environmental	Open in IMG/M
3300012511	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013770	Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M	Environmental	Open in IMG/M
3300014313	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015197	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019883	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021518 (restricted)	Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG	Environmental	Open in IMG/M
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300022901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4	Environmental	Open in IMG/M
3300023064	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025461	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026058	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026069	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026374	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300027548	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027829	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027840	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300028596	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14	Environmental	Open in IMG/M
3300028652	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3	Environmental	Open in IMG/M
3300028679	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3	Environmental	Open in IMG/M
3300028804	Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt	Engineered	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028861	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4	Environmental	Open in IMG/M
3300028870	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4	Environmental	Open in IMG/M
3300029923	II_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300030052	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031722	II_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031795	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19	Environmental	Open in IMG/M
3300031798	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032064	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M
3300034197	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F006851

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign