Basic Information | |
---|---|
Taxon OID | 3300028029 Open in IMG/M |
Scaffold ID | Ga0256845_1089464 Open in IMG/M |
Source Dataset Name | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Riftia |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1096 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean: East Pacific Rise | |||||||
Coordinates | Lat. (o) | 9.8441 | Long. (o) | -104.2967 | Alt. (m) | Depth (m) | 2503 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023595 | Metagenome / Metatranscriptome | 209 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256845_10894642 | F023595 | N/A | MVDFGSGQGLSDFETAGIAGYFEDFKRAKTQPWAERCRLWMGNN |
⦗Top⦘ |