NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209382_10074180

Scaffold Ga0209382_10074180


Overview

Basic Information
Taxon OID3300027909 Open in IMG/M
Scaffold IDGa0209382_10074180 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4017
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8443Long. (o)-83.9607Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016640Metagenome / Metatranscriptome245Y
F021438Metagenome / Metatranscriptome219Y
F046231Metagenome / Metatranscriptome151Y
F055478Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0209382_100741801F016640GGAGMISILFIIALVAGVGWFAWSRWTYWRTPITPQPSEDHSPKARAFEAFMHGNTCLAAGHFADATTAFEQARTLDPKRPYVAERLAEVARQQHAGMAPAPVAAGG
Ga0209382_100741802F055478GGAGGMMGRWGMRSMQDFTVEELARLRQKLDGWIRHRAHTPERPQPRPWVRHPHPAHRRETP
Ga0209382_100741804F046231AGGAMRPRRAYPSLVMGLQVLVTHAASVTIMEREMGYPPRIIRPPDLCYLFQAHDAERLPGLVDRWDAYGIAAQVVQIVPDEAP
Ga0209382_100741805F021438AGGAMPLVKTPTQLRLTQDLLERADDLIAVMAADPEVRAIGMPTRTAVLRLAIARGLRDLEDQYQVPPPAYASAPRPTPHDATPGSCEGTLSHLYVGRGGEAQRVPGTPRNGSGGSRPALKGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.