NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209087_1006379

Scaffold Ga0209087_1006379


Overview

Basic Information
Taxon OID3300027734 Open in IMG/M
Scaffold IDGa0209087_1006379 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6267
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004839Metagenome / Metatranscriptome421N
F010541Metagenome / Metatranscriptome302Y
F033801Metagenome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0209087_100637911F010541N/AMEKNIYTVMYTGNAKRYQDLCHEIAAFSNREAVERFYAAMLNENYFPVDEFSWGGLVYDCDGNVIADAYDECIEYDGGYFYAEQLITV
Ga0209087_100637912F033801N/AMVLMKWEIKWKTGKVITEAPTIESAIQKFKELGIDIPEKEISIASFG
Ga0209087_10063798F004839N/AMEKNFTNTQFRWTFESISDNIPTIMLLTIVLTYGINAYLTAIFLPIDFWLAIIAASILQLGRFAVVFMDFLNPTKGRSTYPPKIALGATIVALIEIFFGLQEQYQGGEFITMFLFVGTIVVFGYLLEINFVDKGVEAYGINEPKVIKRRKRKQFVKKVTEDSPKENKGYVTSFQTITI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.