Basic Information | |
---|---|
Family ID | F033801 |
Family Type | Metagenome |
Number of Sequences | 176 |
Average Sequence Length | 45 residues |
Representative Sequence | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 18.18 % |
% of genes from short scaffolds (< 2000 bps) | 72.16 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (77.841 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.454 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.89% β-sheet: 25.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF12705 | PDDEXK_1 | 14.77 |
PF00692 | dUTPase | 9.09 |
PF01520 | Amidase_3 | 3.98 |
PF01555 | N6_N4_Mtase | 1.14 |
PF05105 | Phage_holin_4_1 | 1.14 |
PF02511 | Thy1 | 0.57 |
PF04765 | DUF616 | 0.57 |
PF01507 | PAPS_reduct | 0.57 |
PF13392 | HNH_3 | 0.57 |
PF01832 | Glucosaminidase | 0.57 |
PF04586 | Peptidase_S78 | 0.57 |
PF05065 | Phage_capsid | 0.57 |
PF01041 | DegT_DnrJ_EryC1 | 0.57 |
PF04466 | Terminase_3 | 0.57 |
PF04002 | RadC | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 9.09 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 9.09 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 3.98 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.14 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.14 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.14 |
COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 1.14 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.57 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.57 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.57 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.57 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.57 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.57 |
COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.57 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.57 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.57 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.77 % |
Unclassified | root | N/A | 10.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001533|MLSed_10002036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30357 | Open in IMG/M |
3300001533|MLSed_10060556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2366 | Open in IMG/M |
3300002296|B570J29587_1002075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1816 | Open in IMG/M |
3300002390|B570J29645_101752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1431 | Open in IMG/M |
3300002408|B570J29032_109135682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300002408|B570J29032_109245738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300002835|B570J40625_100004108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27278 | Open in IMG/M |
3300002835|B570J40625_100155494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2596 | Open in IMG/M |
3300003393|JGI25909J50240_1059064 | Not Available | 786 | Open in IMG/M |
3300005525|Ga0068877_10366486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300005527|Ga0068876_10179145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
3300005528|Ga0068872_10094118 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300005528|Ga0068872_10359622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300005528|Ga0068872_10420217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300005581|Ga0049081_10005725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4695 | Open in IMG/M |
3300005581|Ga0049081_10334952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300005739|Ga0076948_1016700 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300005739|Ga0076948_1016701 | Not Available | 1293 | Open in IMG/M |
3300005758|Ga0078117_1002045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41370 | Open in IMG/M |
3300005805|Ga0079957_1008821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7781 | Open in IMG/M |
3300006484|Ga0070744_10012557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
3300006484|Ga0070744_10068031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300006484|Ga0070744_10227615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300006802|Ga0070749_10112162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300006802|Ga0070749_10144090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300006802|Ga0070749_10317950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300006805|Ga0075464_10222408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300007708|Ga0102859_1058908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300007708|Ga0102859_1105811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300007708|Ga0102859_1276371 | Not Available | 506 | Open in IMG/M |
3300007960|Ga0099850_1251873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300008114|Ga0114347_1006166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6483 | Open in IMG/M |
3300008122|Ga0114359_1055801 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1427 | Open in IMG/M |
3300008266|Ga0114363_1021930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2800 | Open in IMG/M |
3300008266|Ga0114363_1061820 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1452 | Open in IMG/M |
3300008339|Ga0114878_1039175 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
3300008450|Ga0114880_1009508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4846 | Open in IMG/M |
3300008450|Ga0114880_1020920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3048 | Open in IMG/M |
3300008450|Ga0114880_1043156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1945 | Open in IMG/M |
3300009009|Ga0105105_11012516 | Not Available | 517 | Open in IMG/M |
3300009081|Ga0105098_10033770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2022 | Open in IMG/M |
3300009081|Ga0105098_10400596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300009081|Ga0105098_10616580 | Not Available | 567 | Open in IMG/M |
3300009081|Ga0105098_10672274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300009082|Ga0105099_10321159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300009082|Ga0105099_11057334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300009085|Ga0105103_10222618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
3300009146|Ga0105091_10154731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
3300009149|Ga0114918_10266360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300009149|Ga0114918_10367726 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 790 | Open in IMG/M |
3300009157|Ga0105092_10413049 | Not Available | 769 | Open in IMG/M |
3300009158|Ga0114977_10048051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 2647 | Open in IMG/M |
3300009165|Ga0105102_10120028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
3300009165|Ga0105102_10140608 | Not Available | 1169 | Open in IMG/M |
3300009165|Ga0105102_10361821 | Not Available | 764 | Open in IMG/M |
3300009165|Ga0105102_10786228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009168|Ga0105104_10205065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300009168|Ga0105104_10291121 | Not Available | 896 | Open in IMG/M |
3300009169|Ga0105097_10014023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4172 | Open in IMG/M |
3300009169|Ga0105097_10068065 | Not Available | 1930 | Open in IMG/M |
3300009170|Ga0105096_10097470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300009170|Ga0105096_10293137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
3300009170|Ga0105096_10649424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300009183|Ga0114974_10010800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6613 | Open in IMG/M |
3300009184|Ga0114976_10026243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3525 | Open in IMG/M |
3300009450|Ga0127391_1108074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300009451|Ga0127402_1100072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300009484|Ga0127411_1168778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300010354|Ga0129333_10689498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300010370|Ga0129336_10323470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300011009|Ga0129318_10209150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300012013|Ga0153805_1001795 | All Organisms → Viruses → Predicted Viral | 4154 | Open in IMG/M |
3300012013|Ga0153805_1005161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2309 | Open in IMG/M |
3300012013|Ga0153805_1010851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300012017|Ga0153801_1025774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300012348|Ga0157140_10003210 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
3300013004|Ga0164293_10132592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1873 | Open in IMG/M |
3300013004|Ga0164293_10329214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300013004|Ga0164293_10496555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300013004|Ga0164293_10883787 | Not Available | 563 | Open in IMG/M |
3300013004|Ga0164293_10883789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10584169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10066651 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 2559 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10946946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 532 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10761897 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 567 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10348801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300013372|Ga0177922_10837809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300013372|Ga0177922_10913236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1893 | Open in IMG/M |
3300017722|Ga0181347_1123747 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 721 | Open in IMG/M |
3300017761|Ga0181356_1198209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300017774|Ga0181358_1004822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5778 | Open in IMG/M |
3300017774|Ga0181358_1043011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1730 | Open in IMG/M |
3300017784|Ga0181348_1330410 | Not Available | 502 | Open in IMG/M |
3300017785|Ga0181355_1228192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300019784|Ga0181359_1001486 | Not Available | 6301 | Open in IMG/M |
3300019784|Ga0181359_1083397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
3300019784|Ga0181359_1095216 | Not Available | 1099 | Open in IMG/M |
3300019784|Ga0181359_1225908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300019784|Ga0181359_1240987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300020048|Ga0207193_1025110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7192 | Open in IMG/M |
3300020048|Ga0207193_1792230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300020205|Ga0211731_10498748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300020505|Ga0208088_1000317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8084 | Open in IMG/M |
3300020527|Ga0208232_1000265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11600 | Open in IMG/M |
3300020530|Ga0208235_1024694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300020536|Ga0207939_1019455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300020551|Ga0208360_1004446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2222 | Open in IMG/M |
3300022190|Ga0181354_1033318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1691 | Open in IMG/M |
3300022407|Ga0181351_1035625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2110 | Open in IMG/M |
3300022407|Ga0181351_1203931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300024346|Ga0244775_10040157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4123 | Open in IMG/M |
3300024346|Ga0244775_10147764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
3300024348|Ga0244776_10283697 | Not Available | 1138 | Open in IMG/M |
3300024348|Ga0244776_10392177 | Not Available | 923 | Open in IMG/M |
3300025889|Ga0208644_1207287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300025896|Ga0208916_10183777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
3300027631|Ga0208133_1168961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300027683|Ga0209392_1234417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300027721|Ga0209492_1018484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2381 | Open in IMG/M |
3300027721|Ga0209492_1090459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
3300027734|Ga0209087_1006379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6267 | Open in IMG/M |
3300027734|Ga0209087_1008000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5531 | Open in IMG/M |
3300027743|Ga0209593_10060571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1440 | Open in IMG/M |
3300027764|Ga0209134_10291856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300027792|Ga0209287_10146871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300027793|Ga0209972_10001928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17452 | Open in IMG/M |
3300027793|Ga0209972_10026072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3470 | Open in IMG/M |
3300027793|Ga0209972_10235548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300027808|Ga0209354_10118076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1083 | Open in IMG/M |
3300027899|Ga0209668_10281149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300027899|Ga0209668_10719002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300027900|Ga0209253_10057245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3227 | Open in IMG/M |
3300027956|Ga0209820_1083806 | Not Available | 860 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1095568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1185533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300031539|Ga0307380_10249076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1680 | Open in IMG/M |
3300031565|Ga0307379_10920136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
3300031578|Ga0307376_10092673 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
3300031758|Ga0315907_10023537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5661 | Open in IMG/M |
3300031857|Ga0315909_10008586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11175 | Open in IMG/M |
3300031857|Ga0315909_10013858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8370 | Open in IMG/M |
3300031857|Ga0315909_10244791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1381 | Open in IMG/M |
3300031857|Ga0315909_10773140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300031857|Ga0315909_10864989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300032092|Ga0315905_10066575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3651 | Open in IMG/M |
3300032093|Ga0315902_10040557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5470 | Open in IMG/M |
3300032093|Ga0315902_10158352 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 2343 | Open in IMG/M |
3300033816|Ga0334980_0004142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6541 | Open in IMG/M |
3300033979|Ga0334978_0300005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300033981|Ga0334982_0162605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300033981|Ga0334982_0399954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300033993|Ga0334994_0329635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300033993|Ga0334994_0472554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300033995|Ga0335003_0310677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300034012|Ga0334986_0015290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5352 | Open in IMG/M |
3300034012|Ga0334986_0131858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1461 | Open in IMG/M |
3300034022|Ga0335005_0015991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5311 | Open in IMG/M |
3300034062|Ga0334995_0527012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300034062|Ga0334995_0741784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300034063|Ga0335000_0143881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
3300034063|Ga0335000_0775224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300034068|Ga0334990_0087347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 1684 | Open in IMG/M |
3300034068|Ga0334990_0320308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300034071|Ga0335028_0226954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300034073|Ga0310130_0000975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17152 | Open in IMG/M |
3300034082|Ga0335020_0358812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300034105|Ga0335035_0000724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25627 | Open in IMG/M |
3300034110|Ga0335055_0473887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300034118|Ga0335053_0188296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
3300034120|Ga0335056_0181437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
3300034280|Ga0334997_0375633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300034280|Ga0334997_0790660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300034283|Ga0335007_0670694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300034356|Ga0335048_0363512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis | 729 | Open in IMG/M |
3300034357|Ga0335064_0016209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3877 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 15.34% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.20% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.11% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.41% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.41% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.84% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.84% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.27% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.27% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.70% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 1.70% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.70% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.70% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.70% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.70% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.14% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.14% |
Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 1.14% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.14% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.14% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.57% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.57% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002390 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009484 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
MLSed_1000203634 | 3300001533 | Benthic | MVLMKYEIKWKLGKVITEAPTVEEAIKKFKEMRIEVPDKEITISKFGK* |
MLSed_100605567 | 3300001533 | Benthic | MYWEIKWKSGRIITNATTVEEAIENFKKLRIEVPDKEITISKFGK* |
B570J29587_10020755 | 3300002296 | Freshwater | MVRMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEI |
B570J29645_1017522 | 3300002390 | Freshwater | MKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK* |
B570J29032_1091356821 | 3300002408 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN*FCPVSHWYGIF |
B570J29032_1092457381 | 3300002408 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFN* |
B570J40625_10000410820 | 3300002835 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIALFG* |
B570J40625_1001554945 | 3300002835 | Freshwater | MKYEIKWKEGKVITDALTVEEAIQKFKELGIEVPDKEISISKFGK* |
JGI25909J50240_10590644 | 3300003393 | Freshwater Lake | MKWEIKWKSGKVITEAPTIEEAIKKFKELGIDVPKKEISICNFGK* |
Ga0068877_103664861 | 3300005525 | Freshwater Lake | MKYEIRWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0068876_101791453 | 3300005527 | Freshwater Lake | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF* |
Ga0068872_100941182 | 3300005528 | Freshwater Lake | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ* |
Ga0068872_103596223 | 3300005528 | Freshwater Lake | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF* |
Ga0068872_104202171 | 3300005528 | Freshwater Lake | LDKKMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF* |
Ga0049081_100057254 | 3300005581 | Freshwater Lentic | MKYEIKWKSGRIITEAETVEDAIKKFKELGIDVPEKEISIASFG* |
Ga0049081_103349521 | 3300005581 | Freshwater Lentic | MKYEIKWKSGRIITEAESIEDAIKKFKELGIEVADKEISIASFG* |
Ga0076948_10167003 | 3300005739 | Lake Water | MKFEIKWKGGRIITEAPDIEEAIKKFKELRIEVTEKEISIASFPWRSF* |
Ga0076948_10167014 | 3300005739 | Lake Water | MKFEIKWKGGRIITEAPDIEEAIKKFKELQIEVTEKEISIASFPWRSF* |
Ga0078117_100204516 | 3300005758 | Lake Water | MKFEIKWKGGRIITEASDIEEAIKKFKELRIIVTEKEISIASFPWRSF* |
Ga0079957_10088219 | 3300005805 | Lake | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG* |
Ga0070744_100125573 | 3300006484 | Estuarine | MKYEIRWKTGKVITEAPNIEEAIKKFKQLRIEVPDKEINISSFGK* |
Ga0070744_100680313 | 3300006484 | Estuarine | MKYEIKWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0070744_102276151 | 3300006484 | Estuarine | MKYEIKWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0070749_101121624 | 3300006802 | Aqueous | MKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF* |
Ga0070749_101440902 | 3300006802 | Aqueous | MVLMKWQIKWKTGKVITEAPTIEEAIKKFKQLGIDVPDKEISIASFG* |
Ga0070749_103179503 | 3300006802 | Aqueous | MKYEIKWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0075464_102224081 | 3300006805 | Aqueous | MKYEIKWKSGRIITDAASVEEAIKKFKELGIEIPEKQISIASFQ* |
Ga0102859_10589083 | 3300007708 | Estuarine | MVLMYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK* |
Ga0102859_11058114 | 3300007708 | Estuarine | MYWEIKWKSGRIIANAPTVEEAIENFKKLRIEVPD |
Ga0102859_12402783 | 3300007708 | Estuarine | VITEAPNIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0102859_12763713 | 3300007708 | Estuarine | MYWEIKWKSGRIITNAQTVEEAIENFKKLRIEVPDKEITISKFGK* |
Ga0099850_12518734 | 3300007960 | Aqueous | MKYEIKWKSGRIITAAASVEEAIKKFKELGIEVPEKEISIASF* |
Ga0114347_100616611 | 3300008114 | Freshwater, Plankton | MKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF* |
Ga0114359_10558014 | 3300008122 | Freshwater, Plankton | MVLMKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF* |
Ga0114363_10219308 | 3300008266 | Freshwater, Plankton | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVKDKEISIASFG* |
Ga0114363_10618204 | 3300008266 | Freshwater, Plankton | MKYEIKWKSGRIITDAANVEEAIKKFKELGIEIPEKEISIASF* |
Ga0114878_10391754 | 3300008339 | Freshwater Lake | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ* |
Ga0114880_10095086 | 3300008450 | Freshwater Lake | MKYEIKWKSGRIITDAATVEEAIKKFKELGIKVPEKEISIASFQ* |
Ga0114880_10209204 | 3300008450 | Freshwater Lake | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIAEKEISIASFQ* |
Ga0114880_10431564 | 3300008450 | Freshwater Lake | MVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG* |
Ga0105105_110125161 | 3300009009 | Freshwater Sediment | MYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFNK* |
Ga0105098_100337704 | 3300009081 | Freshwater Sediment | MYYEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK* |
Ga0105098_104005962 | 3300009081 | Freshwater Sediment | MKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG* |
Ga0105098_106165801 | 3300009081 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFNK* |
Ga0105098_106722741 | 3300009081 | Freshwater Sediment | MKFEVKWKTGKVITEAETIEEAIQKFKELGIDVPDKEISICKFGK* |
Ga0105099_103211593 | 3300009082 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK* |
Ga0105099_110573341 | 3300009082 | Freshwater Sediment | MKYEIKWKSGKVITEAPTVEEAIKKFKEMRIEILEKEITISKFGK* |
Ga0105103_102226183 | 3300009085 | Freshwater Sediment | MYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK* |
Ga0105091_101547311 | 3300009146 | Freshwater Sediment | LMKYEIKWKQGKVITEAESIEDAINKFKELGIEVPDKEISICKFGK* |
Ga0114918_102663604 | 3300009149 | Deep Subsurface | KSGRIKTDAASVEEAIKKFKELGIEVPEKEISIASF* |
Ga0114918_103677261 | 3300009149 | Deep Subsurface | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEISIASF* |
Ga0105092_104130493 | 3300009157 | Freshwater Sediment | MVLMYWEIKWKSGRIITNSSTVEEAIENFKKLKIEVPDKE |
Ga0114977_100480511 | 3300009158 | Freshwater Lake | MKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISI |
Ga0105102_101200283 | 3300009165 | Freshwater Sediment | MVLMYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK* |
Ga0105102_101406081 | 3300009165 | Freshwater Sediment | MYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISICKFGK* |
Ga0105102_103618211 | 3300009165 | Freshwater Sediment | MYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK* |
Ga0105102_107862282 | 3300009165 | Freshwater Sediment | MKYEIKWKSGKVITEASTVEEAIKKFKEMRIEIPEKEITISKFGK* |
Ga0105104_102050652 | 3300009168 | Freshwater Sediment | MVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG* |
Ga0105104_102911211 | 3300009168 | Freshwater Sediment | MKFEVKWKTGKVITEAETIEEAIQKFKELGIEVTDKEISICKFGK* |
Ga0105097_100140231 | 3300009169 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEKAIENFKKLKIEVPDKEISISKFGK* |
Ga0105097_100680657 | 3300009169 | Freshwater Sediment | MYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK* |
Ga0105096_100974703 | 3300009170 | Freshwater Sediment | MKYEIKWKSGRIITDAENVEDAIKKFKELGIEVEDKEISIASFG* |
Ga0105096_102931372 | 3300009170 | Freshwater Sediment | MKYEIKWKSGKIITEAESIEDAIKKFKELGIDVPDKEISICKFGK* |
Ga0105096_106494242 | 3300009170 | Freshwater Sediment | HFKKMVLMYYEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK* |
Ga0114974_1001080012 | 3300009183 | Freshwater Lake | MKWEIKWKTGKVITEAPTIESAIQKFKELGIDIPEKEISIASFG* |
Ga0114976_100262436 | 3300009184 | Freshwater Lake | MKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISIASFG* |
Ga0127391_11080742 | 3300009450 | Meromictic Pond | MKYEIKWKTGRIKTDAASVEEAIKKFKELGIDIPEKEISIASF* |
Ga0127402_11000721 | 3300009451 | Meromictic Pond | MVLMKYEIKWKSGRIKTDAASLEEAIKKFKELGIDIPEKEISIASF* |
Ga0127411_11687782 | 3300009484 | Meromictic Pond | MKYEIKWKSGKIITDAASVEEAIKKFKELGIDIPEKEISIASF* |
Ga0129333_106894982 | 3300010354 | Freshwater To Marine Saline Gradient | MKYEIKWNGGKMILQAANVEEEIKRFKELGIEVIEKEISIASFG* |
Ga0129336_103234703 | 3300010370 | Freshwater To Marine Saline Gradient | MKYEIKWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0129318_102091501 | 3300011009 | Freshwater To Marine Saline Gradient | IKWKTGSKAIDAENIEEAIKKFKELRIEVPDKEISISSFGK* |
Ga0153805_10017951 | 3300012013 | Surface Ice | KKVVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG* |
Ga0153805_10051615 | 3300012013 | Surface Ice | MKYEIKWKSGRIITDAESIEDAIKKFKELGIDVEDKEISIASFG* |
Ga0153805_10108514 | 3300012013 | Surface Ice | KKVVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG* |
Ga0153801_10257741 | 3300012017 | Freshwater | KKVVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVEDKEISIASFG* |
Ga0157140_100032105 | 3300012348 | Freshwater | MVLKKYEIKWKEGIKTIEAENIEEAIKKFKELRIEVPDKEISVLSFGKWFKISIGFW* |
Ga0164293_101325923 | 3300013004 | Freshwater | MVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFG* |
Ga0164293_103292144 | 3300013004 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG* |
Ga0164293_104965552 | 3300013004 | Freshwater | MKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK* |
Ga0164293_108837873 | 3300013004 | Freshwater | MYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK* |
Ga0164293_108837893 | 3300013004 | Freshwater | MYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK* |
(restricted) Ga0172366_105841692 | 3300013128 | Sediment | MKFQIKWKGGRIITETPNVEEAIKKFKELRIEVTEKEISIASFPWRSI* |
(restricted) Ga0172364_100666515 | 3300013129 | Sediment | MKFQIKWKDGKIITEAPNVEEAIKKFKELRIEVTEKEISIASFPWRSI* |
(restricted) Ga0172363_109469463 | 3300013130 | Sediment | MKFQIKWKGGRIITEAPNVEEAIKKFKELQIEVTE |
(restricted) Ga0172373_107618973 | 3300013131 | Freshwater | MKFQIKWKGGRIITEAPNVEEAIKKFKELRIPVTEKEISIASFPWRSI* |
(restricted) Ga0172372_103488013 | 3300013132 | Freshwater | MKFQIKWKDGKIITEAPNVEEAIKKFKELRIPVTEKEISIASFPWRSI* |
Ga0177922_108378092 | 3300013372 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKEMGIEVEGKEISIASFG* |
Ga0177922_109132362 | 3300013372 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG* |
Ga0181347_11237473 | 3300017722 | Freshwater Lake | MKYEIKWKSGRIITDAESIEDAIKKFKELNIEVEDKEISIA |
Ga0181356_11982091 | 3300017761 | Freshwater Lake | VVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0181358_10048223 | 3300017774 | Freshwater Lake | MVLRKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0181358_10430116 | 3300017774 | Freshwater Lake | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVED |
Ga0181348_13304101 | 3300017784 | Freshwater Lake | KWKSGRIITEAETVEDAIKKFKELGIDVPEKEISIASFG |
Ga0181355_12281922 | 3300017785 | Freshwater Lake | MKWEIKWKSGKVITEAPTIEEAIQKFKELGIDVPEKEISICKFGK |
Ga0181359_10014861 | 3300019784 | Freshwater Lake | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0181359_10833974 | 3300019784 | Freshwater Lake | KYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0181359_10952164 | 3300019784 | Freshwater Lake | MKWEIKWKSGKVITEAPTIEEAIKKFKELGIDVPKKEISICNFGK |
Ga0181359_12259083 | 3300019784 | Freshwater Lake | MKYEIKWKSGRIITDAESIEDAIKKFKELNIEVEDKEISIASFG |
Ga0181359_12409871 | 3300019784 | Freshwater Lake | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG |
Ga0207193_10251101 | 3300020048 | Freshwater Lake Sediment | MYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKE |
Ga0207193_17922302 | 3300020048 | Freshwater Lake Sediment | KWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0211731_104987483 | 3300020205 | Freshwater | MKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF |
Ga0208088_100031710 | 3300020505 | Freshwater | MKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0208232_100026519 | 3300020527 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIALFG |
Ga0208235_10246943 | 3300020530 | Freshwater | GRIITDAETVEDAIKKFKELGIEVEDKEISIASFG |
Ga0207939_10194552 | 3300020536 | Freshwater | MVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG |
Ga0208360_10044465 | 3300020551 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN |
Ga0181354_10333182 | 3300022190 | Freshwater Lake | MKYEIKWKSGKIITDAESIEDAIKKFKELGIDVPEKEISIASFG |
Ga0181351_10356253 | 3300022407 | Freshwater Lake | MKWEIKWKSGKIITEAPTIEEAIKKFKELGIEVEDKEISIASIG |
Ga0181351_12039311 | 3300022407 | Freshwater Lake | KMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0244775_100401571 | 3300024346 | Estuarine | MYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK |
Ga0244775_101477641 | 3300024346 | Estuarine | MKYEIRWKTGKVITEAPNIEEAIKKFKQLRIEVPDKEINISSFGK |
Ga0244776_102836974 | 3300024348 | Estuarine | MYWEIKWKSGRIIANAPTVEEAIENFKKLRIEVPDKEISISKFGK |
Ga0244776_103921774 | 3300024348 | Estuarine | MVLMYWEIKWKSGRIITNAQTVEEAIENFKKLRIEVPDKEITISKFGK |
Ga0208644_12072874 | 3300025889 | Aqueous | MKYEIKWKSGRIKTDAASLEEAIKKFKELGIDIPEKEISIASF |
Ga0208916_101837772 | 3300025896 | Aqueous | MKYEIKWKSGRIITDAASVEEAIKKFKELGIEIPEKQISIASFQ |
Ga0208133_11689611 | 3300027631 | Estuarine | YEIKWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0209392_12344172 | 3300027683 | Freshwater Sediment | MKYEIKWKSGKIITEAESIEDAIKKFKELGIDVPDKEISICKFGK |
Ga0209492_10184841 | 3300027721 | Freshwater Sediment | MYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK |
Ga0209492_10904593 | 3300027721 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEKAIENFKKLKIEVPDKEISISKFGK |
Ga0209087_100637912 | 3300027734 | Freshwater Lake | MVLMKWEIKWKTGKVITEAPTIESAIQKFKELGIDIPEKEISIASFG |
Ga0209087_100800013 | 3300027734 | Freshwater Lake | MKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISIASFG |
Ga0209593_100605714 | 3300027743 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK |
Ga0209134_102918563 | 3300027764 | Freshwater Lake | MKYEIKWKEGKVITEAPTIEEAIQKFKELGIEVPDKEISICKFGK |
Ga0209287_101468713 | 3300027792 | Freshwater Sediment | MYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK |
Ga0209972_1000192811 | 3300027793 | Freshwater Lake | MKYEIRWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0209972_100260726 | 3300027793 | Freshwater Lake | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ |
Ga0209972_102355482 | 3300027793 | Freshwater Lake | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF |
Ga0209354_101180761 | 3300027808 | Freshwater Lake | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEI |
Ga0209668_102811492 | 3300027899 | Freshwater Lake Sediment | MKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPNKEISIASFGK |
Ga0209668_107190023 | 3300027899 | Freshwater Lake Sediment | MKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFDK |
Ga0209253_100572454 | 3300027900 | Freshwater Lake Sediment | MVLMKWEIKWKSGKVITEAPTVEEAIKKFKEMRIEVQDKEITISKFGK |
Ga0209820_10838064 | 3300027956 | Freshwater Sediment | MKWEIKWKQGKIITEAPTVEEAIQKFKELGIDIPDKEISICKFGK |
(restricted) Ga0247843_10955681 | 3300028569 | Freshwater | MKYEIRWKTGKVITEAANIEEAIKKFKELRIEVIDKDINISSFGK |
(restricted) Ga0247843_11855331 | 3300028569 | Freshwater | MKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVIDKDINISSFGK |
Ga0307380_102490764 | 3300031539 | Soil | MKYEIKWKSGRIKTDAASVEEAIKKFKELRIEVPEKEISIASF |
Ga0307379_109201362 | 3300031565 | Soil | MKYEIKWKSGRIKTDAASVEEAIKKFKELGIDIPGKEISIASF |
Ga0307376_100926735 | 3300031578 | Soil | MKYEIKWKSGRIKTDAASVEEAIKKFKELGIDIPEKEISIASF |
Ga0315907_100235375 | 3300031758 | Freshwater | MKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF |
Ga0315909_1000858613 | 3300031857 | Freshwater | MKYEIKWKSGRIITDAATVEEAIKKFKELGIKVPEKEISIASFQ |
Ga0315909_1001385815 | 3300031857 | Freshwater | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDIAEKEISIASFQ |
Ga0315909_102447911 | 3300031857 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVKDKEISIA |
Ga0315909_107731402 | 3300031857 | Freshwater | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASFQ |
Ga0315909_108649892 | 3300031857 | Freshwater | MKYEIKWKSGRIITDAANVEEAIKKFKELGIEIPEKEISIASF |
Ga0315905_100665758 | 3300032092 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEIEISIASFG |
Ga0315902_1004055713 | 3300032093 | Freshwater | MKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ |
Ga0315902_101583522 | 3300032093 | Freshwater | MVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF |
Ga0334980_0004142_4646_4789 | 3300033816 | Freshwater | MVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0334978_0300005_58_192 | 3300033979 | Freshwater | MKYEIKWKSGRIITDAENVEDAIKKFKELGIEVADKEISIASFG |
Ga0334982_0162605_341_475 | 3300033981 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG |
Ga0334982_0399954_472_615 | 3300033981 | Freshwater | MVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG |
Ga0334994_0329635_287_424 | 3300033993 | Freshwater | MKWQIKWKTGKVITDAPTIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0334994_0472554_441_575 | 3300033993 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG |
Ga0335003_0310677_457_594 | 3300033995 | Freshwater | MKYEIKWKTGKVITEAPNIEEAINKFKELRIEVPDKEISIASFGK |
Ga0334986_0015290_1999_2133 | 3300034012 | Freshwater | MKYEIKWKSGRIITDAENVEDAIKKFKELGIEVEDKEISIASFG |
Ga0334986_0131858_57_203 | 3300034012 | Freshwater | MVLMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK |
Ga0335005_0015991_2391_2528 | 3300034022 | Freshwater | MKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0334995_0527012_2_136 | 3300034062 | Freshwater | KYEIKWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK |
Ga0334995_0741784_416_544 | 3300034062 | Freshwater | YEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG |
Ga0335000_0143881_1291_1425 | 3300034063 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGINVPEKEISIASFG |
Ga0335000_0775224_59_193 | 3300034063 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG |
Ga0334990_0087347_261_404 | 3300034068 | Freshwater | MVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFG |
Ga0334990_0320308_634_768 | 3300034068 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKMISIASFG |
Ga0335028_0226954_110_253 | 3300034071 | Freshwater | MVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN |
Ga0310130_0000975_10227_10373 | 3300034073 | Fracking Water | MVLMYWEIKWKSGKVITNAPTVEEAIKKFKEMRIEVPDKEITISKFGK |
Ga0335020_0358812_77_214 | 3300034082 | Freshwater | MKYEIKWKQGKVITEAESIEDAINKFKELGIEVPDKEISICKFGK |
Ga0335035_0000724_24193_24330 | 3300034105 | Freshwater | MKYEIKWKTGKVITEAENIEEAIKKFKELRIKVPDKEISIASFGK |
Ga0335055_0473887_241_375 | 3300034110 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFI |
Ga0335053_0188296_575_709 | 3300034118 | Freshwater | MKWEIKWKSGKVITEAPTIEEAIKKFKELGIEVKDKEISIASFG |
Ga0335056_0181437_3_134 | 3300034120 | Freshwater | KYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG |
Ga0334997_0375633_157_291 | 3300034280 | Freshwater | MKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG |
Ga0334997_0790660_2_115 | 3300034280 | Freshwater | MKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEI |
Ga0335007_0670694_469_585 | 3300034283 | Freshwater | WKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG |
Ga0335048_0363512_582_716 | 3300034356 | Freshwater | MKYEIKWKSGRIITDAKSIEDAIKKFKELGIDVPEKEISIASFG |
Ga0335064_0016209_2215_2352 | 3300034357 | Freshwater | MKYEIRWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK |
⦗Top⦘ |