NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256841_1004989

Scaffold Ga0256841_1004989


Overview

Basic Information
Taxon OID3300026534 Open in IMG/M
Scaffold IDGa0256841_1004989 Open in IMG/M
Source Dataset NameHydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 356-308
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9328
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean: Mid Atlantic Ridge
CoordinatesLat. (o)37.2904Long. (o)-32.2765Alt. (m)Depth (m)1672
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039145Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0256841_10049899F039145N/AMKYFLTSLIVSLTLLTGCSQEGMKAPAELSPFIEALKANGVDGTLLVRAPFNEDMEYVAEYTISRYASTRIISVFKFKDSEKAQENLQEALKNDRLSGQTRNGAFVMAVTFYPPDEEAVEKIKALFLAHEFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.