NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207419_1137098

Scaffold Ga0207419_1137098


Overview

Basic Information
Taxon OID3300025717 Open in IMG/M
Scaffold IDGa0207419_1137098 Open in IMG/M
Source Dataset NameHot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD2A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)734
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.83Long. (o)-121.785Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011397Metagenome / Metatranscriptome291Y

Sequences

Protein IDFamilyRBSSequence
Ga0207419_11370984F011397N/AFDRICDGYVYICDNTSVEERKEWRINLKDLQKTIKKGEKYIYQVAKDSGMFKAMCLSFNNYRIIRKHIFGIDDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.