Basic Information | |
---|---|
Taxon OID | 3300025514 Open in IMG/M |
Scaffold ID | Ga0208490_100787 Open in IMG/M |
Source Dataset Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 15630 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (70.59%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California, McLaughlin Reserve | |||||||
Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067546 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208490_1007875 | F067546 | AGG | VTSLASRSAPLTVRTESGAVVLELGDTLDERTGGVLVDAVASAVATTPERVDIDLTALTGWTAQGATSLVQCREMCRGLPDGLHYRTGRGAGREALLAAYR |
⦗Top⦘ |