NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025514

3300025514: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025514 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053062 | Gp0055495 | Ga0208490
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size99093335
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC262071

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zonerock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001230Metagenome / Metatranscriptome741Y
F050234Metagenome / Metatranscriptome145Y
F059781Metagenome133Y
F067546Metagenome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208490_100067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria91085Open in IMG/M
Ga0208490_100787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15630Open in IMG/M
Ga0208490_101903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC262076804Open in IMG/M
Ga0208490_103832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3734Open in IMG/M
Ga0208490_104201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3475Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208490_100067Ga0208490_10006787F001230MAETAAEAVRNAHRWFEHNSGWAPPDEETLEEWAADGVCRCPDECLVAPDAWCEHGLASWALILAELDRHP
Ga0208490_100787Ga0208490_1007875F067546VTSLASRSAPLTVRTESGAVVLELGDTLDERTGGVLVDAVASAVATTPERVDIDLTALTGWTAQGATSLVQCREMCRGLPDGLHYRTGRGAGREALLAAYR
Ga0208490_101903Ga0208490_1019034F050234VIPPWPLLVLMLEFPVLMALLDCWQRPEDHFAEGAADRRAWLRWLLVAVVTIPVLVGYGIVLGYYYAVVRRSSPASPR
Ga0208490_103832Ga0208490_1038323F059781VHPGQRLRIVTETARAVLDGRLDAEAGAATLALQQGQIADRLRSDRIDVTQAEADEVALTLRRLAEQVSDRTTGPGEVEHRAAIARILGELAQSLR
Ga0208490_104201Ga0208490_1042012F001230VSGAPVDADEAVRNAHRWFEHNSGWAPPDDETLAEWVADGVCRCPDECLVGPRDWCEHGLASWWLILRALEQT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.