Basic Information | |
---|---|
Taxon OID | 3300025377 Open in IMG/M |
Scaffold ID | Ga0208075_1011872 Open in IMG/M |
Source Dataset Name | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #5 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1328 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hot Lake, Oroville, Washington, USA | |||||||
Coordinates | Lat. (o) | 48.973481 | Long. (o) | -119.476345 | Alt. (m) | Depth (m) | .35 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003605 | Metagenome / Metatranscriptome | 477 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208075_10118723 | F003605 | AGGAGG | MAIGDDAQAAGFPIVPESGEEGRVRWGSREFNRTRDFIGQVKALIPGSKSAYRTASGITSGTALPSGGSDGDIYFKIES |
⦗Top⦘ |