Basic Information | |
---|---|
IMG/M Taxon OID | 3300025377 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0067861 | Gp0054702 | Ga0208075 |
Sample Name | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #5 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 125674444 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Predicted Viral | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → hypersaline lake → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Hot Lake, Oroville, Washington, USA | |||||||
Coordinates | Lat. (o) | 48.973481 | Long. (o) | -119.476345 | Alt. (m) | N/A | Depth (m) | .35 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003605 | Metagenome / Metatranscriptome | 477 | Y |
F034704 | Metagenome / Metatranscriptome | 174 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208075_1011872 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
Ga0208075_1012519 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208075_1011872 | Ga0208075_10118723 | F003605 | MAIGDDAQAAGFPIVPESGEEGRVRWGSREFNRTRDFIGQVKALIPGSKSAYRTASGITSGTALPSGGSDGDIYFKIES |
Ga0208075_1012519 | Ga0208075_10125191 | F034704 | TEFLIPLWEKCMDNISGGHVCFNISPKMYEDALIFGLNKSDIDEDLKQQLGQKMNKKTQDKIYIWKV |
⦗Top⦘ |