NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208354_1028425

Scaffold Ga0208354_1028425


Overview

Basic Information
Taxon OID3300025364 Open in IMG/M
Scaffold IDGa0208354_1028425 Open in IMG/M
Source Dataset NameHypersaline microbial mat communities from Hot Lake, Washington, USA - Section #4 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)638
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameHot Lake, Oroville, Washington, USA
CoordinatesLat. (o)48.973481Long. (o)-119.476345Alt. (m)Depth (m).35
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003605Metagenome / Metatranscriptome477Y

Sequences

Protein IDFamilyRBSSequence
Ga0208354_10284252F003605N/AIGDDAQAAGFPIVPESGEEGRVRWGSREFNRTRDFIGQVKALIPGSKSAYRTASGITSGTALPSGGSDGDIYFKIES

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.