Sample 3300025364

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300025364

3300025364: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #4 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300025364 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0067861 \| Gp0054776 \| Ga0208354
Sample Name	Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #4 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	103340022
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hypersaline lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Hot Lake, Oroville, Washington, USA
Coordinates	Lat. (^o)	48.973481	Long. (^o)	-119.476345	Alt. (m)	N/A	Depth (m)	.35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003605	Metagenome / Metatranscriptome	477	Y
F101126	Metagenome / Metatranscriptome	102	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208354_1000394	Not Available	24077	Open in IMG/M
Ga0208354_1028425	Not Available	638	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208354_1000394	Ga0208354_100039426	F101126	MPKFIVDLWLDGYETEEEMEEACEEFIYDQLNMTASSVKIQKIEDDE
Ga0208354_1028425	Ga0208354_10284252	F003605	IGDDAQAAGFPIVPESGEEGRVRWGSREFNRTRDFIGQVKALIPGSKSAYRTASGITSGTALPSGGSDGDIYFKIES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.