NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228703_1001822

Scaffold Ga0228703_1001822


Overview

Basic Information
Taxon OID3300022747 Open in IMG/M
Scaffold IDGa0228703_1001822 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12553
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (89.47%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004260Metagenome / Metatranscriptome446Y
F014846Metagenome / Metatranscriptome259Y
F020865Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0228703_100182217F004260N/AVSLESQLLNRLKAEQQQFAVDALKRPVERDAFEYGYRVGMVAGYEAAINVLLKLLDEEKNLDNDL
Ga0228703_100182218F020865AGGAGMSDKPTPGTVPMTGALVKQHKRMAAGEKVSGQTLPPAPKMPKTPA
Ga0228703_10018226F014846GGAGMSKFLDPTGQPTYGIAICGRCSRKMLLSALSPDPNYPGLMVCEEDRDQYDPYRLAPRRPDQIVLPFNRPDTPINTHPAGVIQEQGDEFIVTEDGNGYLEF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.