Basic Information | |
---|---|
Family ID | F020865 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 221 |
Average Sequence Length | 45 residues |
Representative Sequence | MSDKPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA |
Number of Associated Samples | 161 |
Number of Associated Scaffolds | 221 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 79.82 % |
% of genes near scaffold ends (potentially truncated) | 27.15 % |
% of genes from short scaffolds (< 2000 bps) | 66.06 % |
Associated GOLD sequencing projects | 146 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (48.416 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.529 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.394 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.919 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.70% β-sheet: 0.00% Coil/Unstructured: 86.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 221 Family Scaffolds |
---|---|---|
PF00166 | Cpn10 | 52.94 |
PF14284 | PcfJ | 2.71 |
PF00303 | Thymidylat_synt | 1.36 |
PF11195 | DUF2829 | 0.90 |
PF13385 | Laminin_G_3 | 0.90 |
PF13481 | AAA_25 | 0.45 |
PF08291 | Peptidase_M15_3 | 0.45 |
PF02026 | RyR | 0.45 |
PF07460 | NUMOD3 | 0.45 |
PF00041 | fn3 | 0.45 |
PF02592 | Vut_1 | 0.45 |
PF03237 | Terminase_6N | 0.45 |
PF08774 | VRR_NUC | 0.45 |
PF13023 | HD_3 | 0.45 |
PF12728 | HTH_17 | 0.45 |
PF02195 | ParBc | 0.45 |
COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 52.94 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 1.36 |
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.62 % |
Unclassified | root | N/A | 15.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000405|LV_Brine_h2_0102DRAFT_1001247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7548 | Open in IMG/M |
3300000405|LV_Brine_h2_0102DRAFT_1013321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1709 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102054433 | All Organisms → Viruses | 857 | Open in IMG/M |
3300001580|Draft_10003850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14743 | Open in IMG/M |
3300001605|Draft_10293114 | All Organisms → Viruses | 907 | Open in IMG/M |
3300001605|Draft_10640219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300001850|RCM37_1296489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300001850|RCM37_1396619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300002199|metazooDRAFT_1255350 | Not Available | 871 | Open in IMG/M |
3300002220|MLSBCLC_10512401 | Not Available | 957 | Open in IMG/M |
3300002408|B570J29032_109463381 | All Organisms → Viruses | 783 | Open in IMG/M |
3300002476|metazooDRAFT_10894751 | Not Available | 1068 | Open in IMG/M |
3300002476|metazooDRAFT_10904432 | Not Available | 1367 | Open in IMG/M |
3300002835|B570J40625_100169780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2437 | Open in IMG/M |
3300002835|B570J40625_101315735 | Not Available | 600 | Open in IMG/M |
3300002856|draft_11430642 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300003413|JGI25922J50271_10051316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300003429|JGI25914J50564_10002702 | All Organisms → cellular organisms → Bacteria | 6048 | Open in IMG/M |
3300003430|JGI25921J50272_10071634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300003490|JGI25926J51410_1067172 | Not Available | 598 | Open in IMG/M |
3300003491|JGI25924J51412_1073963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300003493|JGI25923J51411_1037431 | All Organisms → Viruses | 912 | Open in IMG/M |
3300004112|Ga0065166_10015628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2146 | Open in IMG/M |
3300004460|Ga0066222_1412914 | Not Available | 653 | Open in IMG/M |
3300004481|Ga0069718_10143435 | All Organisms → cellular organisms → Bacteria | 4054 | Open in IMG/M |
3300004481|Ga0069718_13917865 | Not Available | 999 | Open in IMG/M |
3300004481|Ga0069718_14600066 | All Organisms → Viruses | 632 | Open in IMG/M |
3300004481|Ga0069718_14673329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300004481|Ga0069718_16075207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2365 | Open in IMG/M |
3300004481|Ga0069718_16273655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300004792|Ga0007761_11116192 | All Organisms → Viruses | 1462 | Open in IMG/M |
3300004795|Ga0007756_11330646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1891 | Open in IMG/M |
3300005525|Ga0068877_10046317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2889 | Open in IMG/M |
3300005528|Ga0068872_10261275 | All Organisms → Viruses | 969 | Open in IMG/M |
3300005580|Ga0049083_10097768 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
3300005581|Ga0049081_10029889 | All Organisms → Viruses → Predicted Viral | 2069 | Open in IMG/M |
3300005581|Ga0049081_10034509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1923 | Open in IMG/M |
3300005582|Ga0049080_10062457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1281 | Open in IMG/M |
3300005583|Ga0049085_10000636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13738 | Open in IMG/M |
3300005584|Ga0049082_10206368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300006037|Ga0075465_10017119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1403 | Open in IMG/M |
3300006802|Ga0070749_10147591 | All Organisms → Viruses | 1369 | Open in IMG/M |
3300006802|Ga0070749_10216517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1093 | Open in IMG/M |
3300006802|Ga0070749_10343488 | All Organisms → Viruses | 830 | Open in IMG/M |
3300006802|Ga0070749_10574977 | All Organisms → Viruses | 609 | Open in IMG/M |
3300006803|Ga0075467_10123365 | All Organisms → Viruses | 1517 | Open in IMG/M |
3300006805|Ga0075464_10196575 | All Organisms → Viruses | 1197 | Open in IMG/M |
3300006863|Ga0075459_1085269 | All Organisms → Viruses | 540 | Open in IMG/M |
3300007171|Ga0102977_1217878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
3300007177|Ga0102978_1145796 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
3300007276|Ga0070747_1253544 | All Organisms → Viruses | 611 | Open in IMG/M |
3300007538|Ga0099851_1200067 | Not Available | 727 | Open in IMG/M |
3300007540|Ga0099847_1138477 | Not Available | 728 | Open in IMG/M |
3300007559|Ga0102828_1131081 | All Organisms → Viruses | 622 | Open in IMG/M |
3300007622|Ga0102863_1077461 | All Organisms → Viruses | 976 | Open in IMG/M |
3300007622|Ga0102863_1158615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 666 | Open in IMG/M |
3300007639|Ga0102865_1208790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300007973|Ga0105746_1023030 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
3300008107|Ga0114340_1105733 | All Organisms → Viruses | 1116 | Open in IMG/M |
3300008259|Ga0114841_1007790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10969 | Open in IMG/M |
3300008262|Ga0114337_1234540 | All Organisms → Viruses | 716 | Open in IMG/M |
3300008266|Ga0114363_1024233 | All Organisms → Viruses | 3683 | Open in IMG/M |
3300008267|Ga0114364_1072700 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
3300008339|Ga0114878_1000322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 32373 | Open in IMG/M |
3300008448|Ga0114876_1099674 | All Organisms → Viruses | 1160 | Open in IMG/M |
3300009009|Ga0105105_10024604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2558 | Open in IMG/M |
3300009068|Ga0114973_10373991 | Not Available | 749 | Open in IMG/M |
3300009081|Ga0105098_10279553 | All Organisms → Viruses | 796 | Open in IMG/M |
3300009085|Ga0105103_10044735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2226 | Open in IMG/M |
3300009085|Ga0105103_10508219 | Not Available | 677 | Open in IMG/M |
3300009151|Ga0114962_10002264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16158 | Open in IMG/M |
3300009151|Ga0114962_10017833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5065 | Open in IMG/M |
3300009151|Ga0114962_10698149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
3300009159|Ga0114978_10464806 | All Organisms → Viruses | 748 | Open in IMG/M |
3300009163|Ga0114970_10205438 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300009164|Ga0114975_10117677 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
3300009164|Ga0114975_10744219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300009165|Ga0105102_10202727 | All Organisms → Viruses | 992 | Open in IMG/M |
3300009169|Ga0105097_10003917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7443 | Open in IMG/M |
3300009182|Ga0114959_10090643 | Not Available | 1690 | Open in IMG/M |
3300009184|Ga0114976_10636914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300009194|Ga0114983_1000535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16059 | Open in IMG/M |
3300010157|Ga0114964_10054623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2080 | Open in IMG/M |
3300010157|Ga0114964_10168653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1059 | Open in IMG/M |
3300010316|Ga0136655_1111595 | All Organisms → Viruses | 823 | Open in IMG/M |
3300010334|Ga0136644_10040133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3062 | Open in IMG/M |
3300010354|Ga0129333_10000175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 44169 | Open in IMG/M |
3300010354|Ga0129333_10019429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Salinisphaerales → Salinisphaeraceae → Salinisphaera → Salinisphaera hydrothermalis | 6464 | Open in IMG/M |
3300010354|Ga0129333_10082957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2970 | Open in IMG/M |
3300010354|Ga0129333_10124807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2370 | Open in IMG/M |
3300010354|Ga0129333_10423548 | All Organisms → Viruses | 1175 | Open in IMG/M |
3300010354|Ga0129333_10961231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300010885|Ga0133913_10773805 | All Organisms → Viruses → Predicted Viral | 2504 | Open in IMG/M |
3300010885|Ga0133913_13502420 | All Organisms → Viruses | 1024 | Open in IMG/M |
3300011114|Ga0151515_10786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13180 | Open in IMG/M |
3300011268|Ga0151620_1221418 | Not Available | 568 | Open in IMG/M |
3300011995|Ga0153800_1013305 | All Organisms → Viruses | 818 | Open in IMG/M |
3300012013|Ga0153805_1017060 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
3300012347|Ga0157142_1000052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 59857 | Open in IMG/M |
3300012667|Ga0157208_10000012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 57931 | Open in IMG/M |
3300012933|Ga0157211_1000017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 53779 | Open in IMG/M |
3300013004|Ga0164293_10051521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3314 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10211238 | All Organisms → Viruses | 1211 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10158047 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
3300013295|Ga0170791_10449058 | All Organisms → Viruses | 587 | Open in IMG/M |
3300015050|Ga0181338_1004253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2458 | Open in IMG/M |
3300015050|Ga0181338_1007649 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
3300017707|Ga0181363_1047456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300017722|Ga0181347_1189603 | Not Available | 545 | Open in IMG/M |
3300017736|Ga0181365_1002343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4549 | Open in IMG/M |
3300017736|Ga0181365_1005159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3220 | Open in IMG/M |
3300017747|Ga0181352_1000175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30763 | Open in IMG/M |
3300017747|Ga0181352_1000490 | All Organisms → Viruses | 16934 | Open in IMG/M |
3300017754|Ga0181344_1005176 | All Organisms → Viruses | 4392 | Open in IMG/M |
3300017754|Ga0181344_1122730 | All Organisms → Viruses | 748 | Open in IMG/M |
3300017754|Ga0181344_1154779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300017754|Ga0181344_1194754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300017761|Ga0181356_1017757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2634 | Open in IMG/M |
3300017761|Ga0181356_1124498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300017766|Ga0181343_1046931 | Not Available | 1276 | Open in IMG/M |
3300017766|Ga0181343_1172745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017774|Ga0181358_1006914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudovirales sp. ctOwN3 | 4801 | Open in IMG/M |
3300017774|Ga0181358_1287933 | Not Available | 504 | Open in IMG/M |
3300017777|Ga0181357_1015777 | All Organisms → Viruses | 3003 | Open in IMG/M |
3300017780|Ga0181346_1035955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2040 | Open in IMG/M |
3300017784|Ga0181348_1281642 | Not Available | 563 | Open in IMG/M |
3300018420|Ga0181563_10017947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5615 | Open in IMG/M |
3300019784|Ga0181359_1011945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3130 | Open in IMG/M |
3300019784|Ga0181359_1051235 | All Organisms → Viruses | 1592 | Open in IMG/M |
3300019784|Ga0181359_1065571 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
3300019784|Ga0181359_1147799 | Not Available | 809 | Open in IMG/M |
3300019784|Ga0181359_1183048 | Not Available | 690 | Open in IMG/M |
3300019784|Ga0181359_1255445 | Not Available | 529 | Open in IMG/M |
3300020048|Ga0207193_1000996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 51148 | Open in IMG/M |
3300020160|Ga0211733_11236399 | All Organisms → Viruses | 721 | Open in IMG/M |
3300020196|Ga0194124_10077114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1970 | Open in IMG/M |
3300021438|Ga0213920_1026732 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300021519|Ga0194048_10013985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3589 | Open in IMG/M |
3300021519|Ga0194048_10201949 | All Organisms → Viruses | 735 | Open in IMG/M |
3300021519|Ga0194048_10229689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300021962|Ga0222713_10700295 | All Organisms → Viruses | 578 | Open in IMG/M |
3300021963|Ga0222712_10095853 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
3300022176|Ga0212031_1089035 | Not Available | 527 | Open in IMG/M |
3300022179|Ga0181353_1001292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5038 | Open in IMG/M |
3300022179|Ga0181353_1006766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2763 | Open in IMG/M |
3300022179|Ga0181353_1012875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2135 | Open in IMG/M |
3300022179|Ga0181353_1028467 | All Organisms → Viruses | 1481 | Open in IMG/M |
3300022179|Ga0181353_1079128 | Not Available | 831 | Open in IMG/M |
3300022190|Ga0181354_1064266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1219 | Open in IMG/M |
3300022407|Ga0181351_1000787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9611 | Open in IMG/M |
3300022407|Ga0181351_1013061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3415 | Open in IMG/M |
3300022407|Ga0181351_1022389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2676 | Open in IMG/M |
3300022407|Ga0181351_1036247 | All Organisms → Viruses | 2089 | Open in IMG/M |
3300022407|Ga0181351_1175812 | Not Available | 742 | Open in IMG/M |
3300022407|Ga0181351_1261794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300022746|Ga0228701_1000211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 56517 | Open in IMG/M |
3300022747|Ga0228703_1001822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12553 | Open in IMG/M |
3300022752|Ga0214917_10048709 | All Organisms → Viruses → Predicted Viral | 2896 | Open in IMG/M |
3300023174|Ga0214921_10010411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11511 | Open in IMG/M |
3300023174|Ga0214921_10011425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10797 | Open in IMG/M |
3300023179|Ga0214923_10465277 | Not Available | 630 | Open in IMG/M |
3300023301|Ga0209414_1000272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24323 | Open in IMG/M |
3300024505|Ga0255150_1058244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300025543|Ga0208303_1121529 | Not Available | 525 | Open in IMG/M |
3300025896|Ga0208916_10239495 | All Organisms → Viruses | 788 | Open in IMG/M |
3300027130|Ga0255089_1004454 | All Organisms → Viruses | 3320 | Open in IMG/M |
3300027130|Ga0255089_1058088 | Not Available | 595 | Open in IMG/M |
3300027213|Ga0208555_1011396 | All Organisms → Viruses | 1392 | Open in IMG/M |
3300027586|Ga0208966_1152043 | All Organisms → Viruses | 612 | Open in IMG/M |
3300027627|Ga0208942_1004464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudovirales sp. ctOwN3 | 4791 | Open in IMG/M |
3300027710|Ga0209599_10002738 | All Organisms → Viruses | 7083 | Open in IMG/M |
3300027712|Ga0209499_1095265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
3300027721|Ga0209492_1022182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2184 | Open in IMG/M |
3300027734|Ga0209087_1243925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300027749|Ga0209084_1031039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2745 | Open in IMG/M |
3300027749|Ga0209084_1094884 | Not Available | 1325 | Open in IMG/M |
3300027762|Ga0209288_10271314 | All Organisms → Viruses | 562 | Open in IMG/M |
3300027777|Ga0209829_10264860 | All Organisms → Viruses | 716 | Open in IMG/M |
3300027782|Ga0209500_10000745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26829 | Open in IMG/M |
3300027793|Ga0209972_10069888 | All Organisms → Viruses | 1840 | Open in IMG/M |
3300027798|Ga0209353_10080366 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
3300027956|Ga0209820_1138014 | All Organisms → Viruses | 671 | Open in IMG/M |
3300028112|Ga0256335_1196972 | All Organisms → Viruses | 522 | Open in IMG/M |
3300028178|Ga0265593_1040468 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
3300028392|Ga0304729_1108129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 939 | Open in IMG/M |
3300031758|Ga0315907_10000533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 54709 | Open in IMG/M |
3300031787|Ga0315900_10175669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1937 | Open in IMG/M |
3300031787|Ga0315900_10531359 | All Organisms → Viruses | 881 | Open in IMG/M |
3300031787|Ga0315900_11040328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300031787|Ga0315900_11130424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300031857|Ga0315909_10050681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3848 | Open in IMG/M |
3300031951|Ga0315904_10412542 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
3300031952|Ga0315294_10422421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1241 | Open in IMG/M |
3300032046|Ga0315289_11392595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300032050|Ga0315906_10306315 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
3300032050|Ga0315906_10390626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1216 | Open in IMG/M |
3300032092|Ga0315905_10893638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300032116|Ga0315903_10598990 | All Organisms → Viruses | 847 | Open in IMG/M |
3300032118|Ga0315277_11316295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 632 | Open in IMG/M |
3300032173|Ga0315268_11329236 | All Organisms → Viruses | 729 | Open in IMG/M |
3300033557|Ga0316617_101756814 | Not Available | 632 | Open in IMG/M |
3300033978|Ga0334977_0005056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7516 | Open in IMG/M |
3300033993|Ga0334994_0580026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300033995|Ga0335003_0377994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300033996|Ga0334979_0120584 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
3300034013|Ga0334991_0048656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2228 | Open in IMG/M |
3300034013|Ga0334991_0235419 | All Organisms → Viruses | 773 | Open in IMG/M |
3300034013|Ga0334991_0268084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300034019|Ga0334998_0776789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300034020|Ga0335002_0627146 | Not Available | 552 | Open in IMG/M |
3300034061|Ga0334987_0609371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300034063|Ga0335000_0723102 | All Organisms → Viruses | 544 | Open in IMG/M |
3300034068|Ga0334990_0101145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1562 | Open in IMG/M |
3300034101|Ga0335027_0000174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58016 | Open in IMG/M |
3300034103|Ga0335030_0221216 | All Organisms → Viruses | 1307 | Open in IMG/M |
3300034104|Ga0335031_0070556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2493 | Open in IMG/M |
3300034122|Ga0335060_0438397 | All Organisms → Viruses | 684 | Open in IMG/M |
3300034280|Ga0334997_0596702 | Not Available | 681 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.95% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.24% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.07% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.62% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.17% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.71% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.26% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.26% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.26% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.36% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.36% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.36% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.81% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.81% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.45% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.45% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.45% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.45% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.45% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.45% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.45% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.45% |
Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.91% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.91% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012933 | Freshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LV_Brine_h2_0102DRAFT_10012479 | 3300000405 | Hypersaline | MSDKPGTGTVPMNSGAVKQKHRLAAGLPVDGKTLPPAPAQGPKTPC* |
LV_Brine_h2_0102DRAFT_10133212 | 3300000405 | Hypersaline | MSDKPTQGTVPMTGALVNQHHRMAAGQPVTGQTLPAAPSMPKTPC* |
JGIcombinedJ13530_1020544334 | 3300001213 | Wetland | GLTQERDKEITMADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA* |
Draft_100038503 | 3300001580 | Hydrocarbon Resource Environments | MSDKPTPGTVPMTGAAVKQKHRMAAGEKVTGQTLPPAPKPDKGPGC* |
Draft_102931141 | 3300001605 | Hydrocarbon Resource Environments | MSDKPTQGTVPMTGALVKQHHRMAAGQPVNGQTTPAAPSMPKTPC* |
Draft_106402191 | 3300001605 | Hydrocarbon Resource Environments | MSDKPTXGTVPMTGALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC* |
RCM37_12964891 | 3300001850 | Marine Plankton | MSDKPTPGTVPMTGPYVKQKHRLAAGEKLNSQTLPAAPKTSPGPKTPA* |
RCM37_13966191 | 3300001850 | Marine Plankton | MSDKPTVGTVPMTGADVKQKHRMAAGEKVDGQSLPPAPKPEKNQA* |
metazooDRAFT_12553501 | 3300002199 | Lake | MSDKPTPGTVPMTGALVKQKHRLAAGEKVTGQTLPAEPKLPKTPA* |
MLSBCLC_105124011 | 3300002220 | Hydrocarbon Resource Environments | MSDKPTPGTVPMTGALVKQKHRMAAGDKTNGQTLPAEPKMPKTPA* |
B570J29032_1094633813 | 3300002408 | Freshwater | MNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA* |
metazooDRAFT_108947511 | 3300002476 | Lake | MADKPTPGTVPLTGALVKQHKRMAAGEALTGQRLPAPPAQPKTRA |
metazooDRAFT_109044322 | 3300002476 | Lake | MADKPTPGTVPMSGPYVKQKHRLAAAEKLNGQTLPAAPKGATSPKCPA* |
B570J40625_1001697802 | 3300002835 | Freshwater | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA* |
B570J40625_1013157351 | 3300002835 | Freshwater | MSDDPNKSKEVQMNSALVKQKHRMAAGEKVDGQSLPPAPKVEKNQA* |
draft_114306422 | 3300002856 | Hydrocarbon Resource Environments | MSDKPTQGTVPMTGALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC* |
JGI25922J50271_100513163 | 3300003413 | Freshwater Lake | MSDKPTQGTVPMTGALVKQHHRMAAGQPVTGQTLPAAPSMPKTPC* |
JGI25914J50564_100027028 | 3300003429 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPKTPA* |
JGI25921J50272_100716343 | 3300003430 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKXEKNQA* |
JGI25926J51410_10671721 | 3300003490 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKCDGQSLPPAPKVEKNQA* |
JGI25924J51412_10739631 | 3300003491 | Freshwater Lake | TQTLKEITMSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPKTPKTPA* |
JGI25923J51411_10374311 | 3300003493 | Freshwater Lake | EIVMSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA* |
Ga0065166_100156282 | 3300004112 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKAEKNQA* |
Ga0066222_14129142 | 3300004460 | Marine | MSDKPTPGTVPMTGALVKQKHRLAAGDKCDGQSLPPTPAMPKTPA* |
Ga0069718_101434352 | 3300004481 | Sediment | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPKTPA* |
Ga0069718_139178652 | 3300004481 | Sediment | MSDKPTPGTVPMTGALVKQKHRMAAGDKTNGQSLPPEPKMPKTPA* |
Ga0069718_146000661 | 3300004481 | Sediment | ENVMSDDPNKAKEVQMNSALVKQKHRMAAGEKVDGQSLPPAPKPEKNQA* |
Ga0069718_146733292 | 3300004481 | Sediment | MSDKPKTGTVPMTGALVKQHHRMAAGEKVTGQNLPPEPKMPKTPA* |
Ga0069718_160752071 | 3300004481 | Sediment | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPK |
Ga0069718_162736552 | 3300004481 | Sediment | MSDDPNKSKEVQMNSAMVKQKHRMAAGEKVDGQSLPPAPKPEKNQA* |
Ga0007761_111161924 | 3300004792 | Freshwater Lake | MADKPKADTVSLNNAYVKQKHRLAAGEKVDGQSLPPAPKVEKNQA* |
Ga0007756_113306462 | 3300004795 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKTEKNQA* |
Ga0068877_100463175 | 3300005525 | Freshwater Lake | MADKPKPGTVPMTGPYVKQKHRMAAGEKVTGQTLPAAPKGATSPKCPA* |
Ga0068872_102612754 | 3300005528 | Freshwater Lake | ERDKEITMADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKAEKNQA* |
Ga0049083_100977684 | 3300005580 | Freshwater Lentic | TPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPKTPA* |
Ga0049081_100298891 | 3300005581 | Freshwater Lentic | IKGSIAMSDKPNPGTVPMTGALVKQKHRMAAGEKVTGQTLPPAPKPEKNRA* |
Ga0049081_100345093 | 3300005581 | Freshwater Lentic | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTPA* |
Ga0049080_100624572 | 3300005582 | Freshwater Lentic | MSDTPKTGTVPMTGAFVKQHHRMAAGEKLNGQTVPSAPSTPKTPA* |
Ga0049085_100006368 | 3300005583 | Freshwater Lentic | MKAKPMKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA* |
Ga0049082_102063683 | 3300005584 | Freshwater Lentic | MSDKPTPGTVPMTGAFVKQKHRLAAGEKCDGQTLPSAPSTPKTPA* |
Ga0075465_100171192 | 3300006037 | Aqueous | MSDKPTPGTVPMTSALVKQHHRMAAGQPVTGQTTPAAPSM |
Ga0070749_101475913 | 3300006802 | Aqueous | MDKPSTGTVPMSGAYVKQKHRLAAGEKVDGQSLPPEPKPEKAKA* |
Ga0070749_102165172 | 3300006802 | Aqueous | MSDKPTPGTVPMTGAYVKQKHRLAAGEKLNGQTLP |
Ga0070749_103434883 | 3300006802 | Aqueous | MSDKPTPGTVPMTGGAVKQHHRLAAGEKLNGQTLPAAPANGPKTPA* |
Ga0070749_105749771 | 3300006802 | Aqueous | MSDKPTPGAVPMTGALVKQHHRMAAGEKLNGQTLPAAPAMPKTPA* |
Ga0075467_101233654 | 3300006803 | Aqueous | MSDKPTPGTVPMTSALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC* |
Ga0075464_101965751 | 3300006805 | Aqueous | MSDKPTPGTVPLTRALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC* |
Ga0075459_10852693 | 3300006863 | Aqueous | MADKPTTGTVPMTGGYVKQKHRLAAGEKLNGQTLPPAPKNEKKTPA* |
Ga0102977_12178782 | 3300007171 | Freshwater Lake | MSDKPTTGTVPMSGPYVKQHHRLAAGEKTNGQTLPGEPKSEKNQA* |
Ga0102978_11457962 | 3300007177 | Freshwater Lake | MSDKPTPGTVPMTGALVKQHHRMAAGQPVTGQTLPAAPTMPKTPA* |
Ga0070747_12535441 | 3300007276 | Aqueous | MPTPNNNTVPMTGALVKQHHRMAAGQPVSGQTLPAAPSTPKTPA* |
Ga0099851_12000671 | 3300007538 | Aqueous | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSSPPEPKAEKNQA* |
Ga0099847_11384772 | 3300007540 | Aqueous | MADKPTPGTVPMTGALVKQKHRMAAGDKTNGQTLPAEPKMPKTPA* |
Ga0099848_10124833 | 3300007541 | Aqueous | MQMADDTKNTKEVPMNNAAVKQKHRMAAGFKTDGQSLPPEPKKEGSKANA* |
Ga0099846_12652261 | 3300007542 | Aqueous | PQPVRRMQMADDTKNTKEVPMNNAAVKQKHRMAAGFKTDGQSLPPEPKKEGSKANA* |
Ga0102828_11310811 | 3300007559 | Estuarine | MKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA* |
Ga0102863_10774612 | 3300007622 | Estuarine | MDKPTPGTVPMNSAAVKQKHRMAAGLPVDGKTLPAAPAMPKTPA* |
Ga0102863_11586152 | 3300007622 | Estuarine | MSDQPKSGTVPLDSCCVKQHHRLAAGLPVDGQKLPSEPATPKTPA* |
Ga0102865_12087902 | 3300007639 | Estuarine | MSDTPKTGTVPMTGAFVKQHHRMAAGEKLNGQTVPSAP |
Ga0105746_10230302 | 3300007973 | Estuary Water | MSDKPTTGTVPMNNAAVKQHHRMAAGVPVTGQTLPSTPVMPKTPA* |
Ga0114340_11057332 | 3300008107 | Freshwater, Plankton | MSDTPKTGTVPMTGAFVKQHHRMAAGEKLNGQTVPSAPTTPKTPA* |
Ga0114841_10077901 | 3300008259 | Freshwater, Plankton | KEITMADKPKEGNVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKAEKNQA* |
Ga0114337_12345403 | 3300008262 | Freshwater, Plankton | MEVTMSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPAAPKTTPGPKTPA* |
Ga0114363_10242336 | 3300008266 | Freshwater, Plankton | MDDKPKNNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPEPKTEKNQA* |
Ga0114364_10727002 | 3300008267 | Freshwater, Plankton | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPKTPKTPA* |
Ga0114878_100032231 | 3300008339 | Freshwater Lake | MEPTMSDKPTPGTVPMTGALVKQHHRMAAGQPVNGQTTPAAPSMPKTPC* |
Ga0114876_10996744 | 3300008448 | Freshwater Lake | MADKPSTGTVSLNSAYVKQKHRLAAGEKVDGQSLPPEPKSEKNQA* |
Ga0105105_100246042 | 3300009009 | Freshwater Sediment | MSDNPNKAKEVPMNSALVKQKHRMAAGEKVDGQSLPPDPKVEKNQA* |
Ga0114973_103739911 | 3300009068 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA* |
Ga0105098_102795533 | 3300009081 | Freshwater Sediment | MSDNPNKSKEVQMNSALVKQKHRMAAGEKVDGQSLPPDPKVEKNQA* |
Ga0105103_100447354 | 3300009085 | Freshwater Sediment | MSDNPNKAKEVPMNSALVKQKHRLAAGEKVDGQSLPPAPKVEKNQA* |
Ga0105103_105082192 | 3300009085 | Freshwater Sediment | MSDKPTPGTVPMTGALVKQKHRMAAGEKVDGQSLPPEPKMPKTPA* |
Ga0114962_1000226416 | 3300009151 | Freshwater Lake | MADKPKPGTVPMTGAFVKQKHRMAAGDKTNGQTLPSAPNTPKTPA* |
Ga0114962_100178332 | 3300009151 | Freshwater Lake | MSDKPTTGTVPMTGADVKQKHRMAAGEKVTGQTLPSAPKVVKTPA* |
Ga0114962_106981492 | 3300009151 | Freshwater Lake | MSDQPKNGTVPMDSALVKQHHRLAAGLPVDGQKLPSAPAAPKTPA* |
Ga0114978_104648061 | 3300009159 | Freshwater Lake | IMSDKPTPGTVRMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTPA* |
Ga0114970_102054384 | 3300009163 | Freshwater Lake | KDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA* |
Ga0114975_101176771 | 3300009164 | Freshwater Lake | PTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPKTPA* |
Ga0114975_107442191 | 3300009164 | Freshwater Lake | MTDKPTTGTVSMTGADVKQKHRLAAGEKVTGQTLPPAPKPAKANY* |
Ga0105102_102027272 | 3300009165 | Freshwater Sediment | MSDNPNKAKEVPMNSALVKQKHRLAAGEKVDGQSLPPDPKVEKNQA* |
Ga0105097_100039179 | 3300009169 | Freshwater Sediment | MSDKPTTGTVPMTGAYVSQHQRMAAGEKIDGQTLPSDKSAGPKTPA* |
Ga0114959_100906432 | 3300009182 | Freshwater Lake | MDDKPKNNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPDPKTEKNQA* |
Ga0114976_106369143 | 3300009184 | Freshwater Lake | MADKPTTGTVPMNNAAVKQHHRMAAGVPVTGQTTPAAPAEKKTPA* |
Ga0114983_10005352 | 3300009194 | Deep Subsurface | MSDKPTTGTVPLNSALVPQHHRMAAGQPVTGQTLPAAPSMPKTPC* |
Ga0114964_100546231 | 3300010157 | Freshwater Lake | MADKPKPGTVPMTGAFVKQKHRMAAGDKTNGQTLP |
Ga0114964_101686531 | 3300010157 | Freshwater Lake | MSDQPKNGTVPMDSALVKQHHRLAAGLPVDGQKLPSEPAAPKTPA* |
Ga0136655_11115953 | 3300010316 | Freshwater To Marine Saline Gradient | MTGALVKQHHRMAAGQPVSGQTLPAAPSTPKTPA* |
Ga0136644_100401333 | 3300010334 | Freshwater Lake | MDKPGTGTVPMTGALVKQKHRLAAGEKLNGQTLPPAPKMPKTPA* |
Ga0129333_100001757 | 3300010354 | Freshwater To Marine Saline Gradient | MSDKPTPGTVPMTGPYVKQKHRLAAGEKLNGQTLPAAPKTAPGPKTPA* |
Ga0129333_100194292 | 3300010354 | Freshwater To Marine Saline Gradient | MDDKPKTGTVPMSGAYVKQKHRLAAGEKVDGQSLPPEPKTEKNQA* |
Ga0129333_100829572 | 3300010354 | Freshwater To Marine Saline Gradient | MSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPPAPKTAPGPKTPA* |
Ga0129333_101248071 | 3300010354 | Freshwater To Marine Saline Gradient | MSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPAAPKTSPGPKTPA* |
Ga0129333_104235484 | 3300010354 | Freshwater To Marine Saline Gradient | MSDKPTTGTVPMTGALVKQHHRMAAGQPVTGQTLPAAPNMPKTPA* |
Ga0129333_109612312 | 3300010354 | Freshwater To Marine Saline Gradient | MSDKPTPGTVPMTGGAVKQHHRMAAGEKLNGQTLPAAPATGPKTPA* |
Ga0133913_107738052 | 3300010885 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQTLPAAPSTPKTPA* |
Ga0133913_135024202 | 3300010885 | Freshwater Lake | MDDKPKKNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPEPKTEKNQA* |
Ga0151515_107863 | 3300011114 | Freshwater | MADKPTAGTVSLNSAYVKQKHRLAAGEKVDGQSLPPEPKSEKNQA* |
Ga0151620_12214183 | 3300011268 | Freshwater | MKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSP |
Ga0153800_10133054 | 3300011995 | Freshwater | TVPMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTPA* |
Ga0153805_10170604 | 3300012013 | Surface Ice | PMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPKTPA* |
Ga0157142_100005223 | 3300012347 | Freshwater | MADKPTTGTVPMNNAAVKQHHRMAAGQPVTGQTTPSAPAEKKTPA* |
Ga0157208_1000001263 | 3300012667 | Freshwater | MADKPTTGTVPMNNAAVKQHHRMAAGVPVTGQTTPSAPAEKKTPA* |
Ga0157211_100001731 | 3300012933 | Freshwater | MSDKPTQGTVPMNGALVKQHHRMAAGQPVTGQTTPAAPSMPKTPA* |
Ga0164293_100515212 | 3300013004 | Freshwater | MSDKPTTGTVPMTGALVKQHKRMAAGEKITGQKLPSEPKMPKTPA* |
(restricted) Ga0172367_102112382 | 3300013126 | Freshwater | MSDKPTPGTVPMTGPYVKQKHRLAAGEKLNGQTLPSAPKTAPGPKTPA* |
(restricted) Ga0172362_101580472 | 3300013133 | Sediment | MSDKPTPGTVPMTGALVKQKHRMAAGEKVDGQTMPPAPKPEKNQA* |
Ga0170791_104490581 | 3300013295 | Freshwater | TVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA* |
Ga0181338_10042532 | 3300015050 | Freshwater Lake | MADKPKAYTVSLNNAYVKQKHRLAAGEKVDGQSLPPAPKVEKNQA* |
Ga0181338_10076494 | 3300015050 | Freshwater Lake | MSDKPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPKTPA* |
Ga0181363_10474562 | 3300017707 | Freshwater Lake | MSDTPKTGTVPMSGAFVKQHHRMAAGEKLNGQTLPSAPTTPKTPA |
Ga0181347_11896032 | 3300017722 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATP |
Ga0181365_10023433 | 3300017736 | Freshwater Lake | MADKPKADTVSLNNAYVKQKHRLAAGEKVDGQPLPPAPKVEKNQA |
Ga0181365_10051594 | 3300017736 | Freshwater Lake | MSDKPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA |
Ga0181352_100017530 | 3300017747 | Freshwater Lake | MDKPTPGTVPLNNGAVKQKHRMAAGLPVDGKTLPAAPAMPKTPA |
Ga0181352_10004901 | 3300017747 | Freshwater Lake | MSDDPNKSKEVQMNSALVKQKHRMAAGEKVDGQSLPPAPKVENNQA |
Ga0181344_10051762 | 3300017754 | Freshwater Lake | MKAKPMKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKYPKTPA |
Ga0181344_11227303 | 3300017754 | Freshwater Lake | MSDKPTPGTVPMTGALVKQHHRMAAGDKTNGQTLPSAPAMPKTPA |
Ga0181344_11547792 | 3300017754 | Freshwater Lake | MADKPTTGTVPMNNAAVKQHHRMAAGQPVTGQTSPSAPAEKKTPA |
Ga0181344_11947542 | 3300017754 | Freshwater Lake | MPKPNTNQVPMDNAAVKQHHRMAAGVPVTGQTTPAAPAEKKTPA |
Ga0181356_10177572 | 3300017761 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPA |
Ga0181356_11244981 | 3300017761 | Freshwater Lake | MNDKPTPGTVPMTSALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC |
Ga0181343_10469312 | 3300017766 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKTEKNQ |
Ga0181343_11727452 | 3300017766 | Freshwater Lake | MSDKPNNNQVPMTGAFVKQHHRMAAGEKVDGQKLPSAPATPKTPA |
Ga0181358_10069143 | 3300017774 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKCDGQTLPA |
Ga0181358_12879332 | 3300017774 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTP |
Ga0181357_10157772 | 3300017777 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKCDGQTLPSAPSTPKTPA |
Ga0181346_10359553 | 3300017780 | Freshwater Lake | MKDKPKTGTVSMKGGDVKQKHRMAAGQKVTGQTLPSAPKSPKTPA |
Ga0181348_12816422 | 3300017784 | Freshwater Lake | MSETPKTGTVPMTGALIKQKHRLAAGEKLNGQTLPPEPKMPKT |
Ga0181563_100179473 | 3300018420 | Salt Marsh | MADKPKPGTVPMTGAFVKQKHRMAAGDKTNGQTLPSAPNTPKTPA |
Ga0181359_10119454 | 3300019784 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKAEKNQA |
Ga0181359_10512354 | 3300019784 | Freshwater Lake | MSDTPKTGTVPMTGALIKQKHRLAAGEKLNGQTLPPEPKMPKTPA |
Ga0181359_10655714 | 3300019784 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPKTPA |
Ga0181359_11477992 | 3300019784 | Freshwater Lake | MADKPKEGTVSMNSAYVKQKHRLAAGEKCDGQSLPPAPKVEKNQA |
Ga0181359_11830482 | 3300019784 | Freshwater Lake | MADKPKADTVSLNNAYVKQKHRLAAGEKVDGQSLPPAPKVEKNQA |
Ga0181359_12554452 | 3300019784 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTPA |
Ga0207193_100099650 | 3300020048 | Freshwater Lake Sediment | MPTPNNNTVPMTGALVKQHHRMAAGQPVSGQTLPAAPSTPKTPA |
Ga0211733_112363991 | 3300020160 | Freshwater | IMADKPTAGTVSLNSAYVKQKHRLAAGEKVDGQSLPPEPKSEKNQA |
Ga0194124_100771144 | 3300020196 | Freshwater Lake | MEDKPTTGTVPMSAPYVKQKHRLAAGEKLDGQSLPPEPKAEKNQA |
Ga0213920_10267323 | 3300021438 | Freshwater | MADKPKTGTVPMTGADVKQKHRLAAGEKLNGQTLPPAPKAPKANY |
Ga0194048_100139852 | 3300021519 | Anoxic Zone Freshwater | MSDKPTTGTVSMATAAVKQKHRMAAGEKVTGQTLPSAPKVVKTPA |
Ga0194048_102019491 | 3300021519 | Anoxic Zone Freshwater | PRKETTMNDKPSTGTVPMTGADVKQKHRLAAGEKVTGQTLPPAPKPSTPNC |
Ga0194048_102296893 | 3300021519 | Anoxic Zone Freshwater | MTDKPTTGTVPMTGADVKQKHRLAAGEKVTGQTLPPAPKPAKANY |
Ga0222714_104463712 | 3300021961 | Estuarine Water | MADDTKNTKEVPMNNAAVKQKHRMAAGFKTDGQSLPPEPKKEGSKANA |
Ga0222713_107002953 | 3300021962 | Estuarine Water | SDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQSLPAAPATPKTPA |
Ga0222712_100958535 | 3300021963 | Estuarine Water | MKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA |
Ga0212031_10890351 | 3300022176 | Aqueous | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPK |
Ga0181353_10012925 | 3300022179 | Freshwater Lake | MSDKPTQGTVPMTGALVKQHHRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0181353_10067662 | 3300022179 | Freshwater Lake | MSDDPNKSKEVQMNSALVKQKHRMAAGEKVDGQSLPPAPKVEKNQA |
Ga0181353_10128752 | 3300022179 | Freshwater Lake | MSDKPTQGTVPMTGALVKQHKRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0181353_10284674 | 3300022179 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQHHRMAAGEKLNGQTLPSAPTTPKTPA |
Ga0181353_10791281 | 3300022179 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAA |
Ga0181354_10642661 | 3300022190 | Freshwater Lake | EGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA |
Ga0181351_100078710 | 3300022407 | Freshwater Lake | MSDKPTTGTVPLNSALVPQHHRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0181351_10130613 | 3300022407 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPL |
Ga0181351_10223892 | 3300022407 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKCDGQTLPAAPSTPKTPA |
Ga0181351_10362472 | 3300022407 | Freshwater Lake | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLNGQTLPATPSTPKTPA |
Ga0181351_11758122 | 3300022407 | Freshwater Lake | MSDKPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPKTPA |
Ga0181351_12617943 | 3300022407 | Freshwater Lake | NNTPVPMTGAFVKQHHRMAAGEKVDGQTVPAAPAMPKTPA |
Ga0228701_100021111 | 3300022746 | Freshwater | MSDKPTQGTVPMTGALVKQHHRMAAGQPVTGQTLPSAPAQSKTPA |
Ga0228703_100182218 | 3300022747 | Freshwater | MSDKPTPGTVPMTGALVKQHKRMAAGEKVSGQTLPPAPKMPKTPA |
Ga0214917_100487095 | 3300022752 | Freshwater | MDKPGTGTVPMTGALVKQKHRLAAGEKLNGQTLPPAPKMPKTPA |
Ga0214921_100104113 | 3300023174 | Freshwater | MSDTPKTGTVPMSGGFVKQHHRMAAGEKLNGQTLPSAPTTPKTPA |
Ga0214921_1001142517 | 3300023174 | Freshwater | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA |
Ga0214923_104652772 | 3300023179 | Freshwater | MDKPGTGTVPMTGALVKQKHRLAAGEKLNGQTLPPAPK |
Ga0209414_100027216 | 3300023301 | Hypersaline | MSDKPTQGTVPMTGALVNQHHRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0255150_10582443 | 3300024505 | Freshwater | MSDKPTTGTVPMTGALIKQHHRMAAGQPVTGQTTPAAPSMPKTPA |
Ga0208303_11215292 | 3300025543 | Aqueous | MADKPTPGTVPMTGALVKQKHRMAAGDKTNGQTLPAEPKM |
Ga0208916_102394951 | 3300025896 | Aqueous | TVPMTSALVKQHHRMAAGQPVTGQTTPAAPSMPKTPC |
Ga0255089_10044548 | 3300027130 | Freshwater | RDKEITMADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKTEKNQA |
Ga0255089_10580882 | 3300027130 | Freshwater | MADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKTE |
Ga0208555_10113963 | 3300027213 | Estuarine | MDKPTPGTVPMNSAAVKQKHRMAAGLPVDGKTLPAAPAMPKTPA |
Ga0208966_11520433 | 3300027586 | Freshwater Lentic | ENTMSDKPTPGTVPMTGAFVKQKHRLAAGEKCDGQTLPSAPSTPKTPA |
Ga0208942_10044643 | 3300027627 | Freshwater Lentic | MKAKPMKDKPKTGTVSMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA |
Ga0209599_100027384 | 3300027710 | Deep Subsurface | MSDKPTQGTVPMTGALVKQHHRMAAGQPVNGQTTPAAPSMPKTPC |
Ga0209499_10952652 | 3300027712 | Freshwater Lake | MDDKPKNNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPEPKTEKNQA |
Ga0209492_10221822 | 3300027721 | Freshwater Sediment | MSDKPTTGTVPMTGAYVSQHQRMAAGEKIDGQTLPSDKSAGPKTPA |
Ga0209087_12439252 | 3300027734 | Freshwater Lake | MADKPTTGTVPMNNAAVKQHHRMAAGVPVTGQTTPAAPAEKKTPA |
Ga0209084_10310392 | 3300027749 | Freshwater Lake | MSDKPTTGTVPMTGADVKQKHRMAAGEKVTGQTLPSAPKVVKTPA |
Ga0209084_10948842 | 3300027749 | Freshwater Lake | MSDQPKNGTVPMDSALVKQHHRLAAGLPVDGQKLPSEPAAPKTPA |
Ga0209288_102713141 | 3300027762 | Freshwater Sediment | SAMSDNPNKAKEVPMNSALVKQKHRMAAGEKVDGQSLPPDPKVEKNQA |
Ga0209829_102648603 | 3300027777 | Freshwater Lake | GTVPMDSALVKQHHRLAAGLPVDGQKLPSAPAAPKTPA |
Ga0209500_1000074514 | 3300027782 | Freshwater Lake | MSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPSTPKTPA |
Ga0209972_100698884 | 3300027793 | Freshwater Lake | MADKPKPGTVPMTGPYVKQKHRMAAGEKVTGQTLPAAPKGATSPKCPA |
Ga0209353_100803661 | 3300027798 | Freshwater Lake | LKEIVMSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPAAPATPKTPA |
Ga0209820_11380143 | 3300027956 | Freshwater Sediment | SDNPNKAKEVPMNSALVKQKHRMAAGEKVDGQSLPPDPKVEKNQA |
Ga0256335_11969723 | 3300028112 | Freshwater | MSGPYVKQKHRLAAGEKLNGQTLPAAPKTAPGPKTPA |
Ga0265593_10404684 | 3300028178 | Saline Water | MSDQPKNGTVPLDSALVKQHHRLAAGLPVNGQKLPSAPATPKTPA |
Ga0304729_11081292 | 3300028392 | Freshwater Lake | MSDQPKNGTVPMDSALVKQHHRLAEGLPVDGQKLPSEPAAPKTPA |
Ga0315907_1000053363 | 3300031758 | Freshwater | MSDKPTPGTVPMTGALVKQHHRMAAGQPVNGQTTPAAPSMPKTPC |
Ga0315900_101756692 | 3300031787 | Freshwater | MSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPAAPKTTPGPKTPA |
Ga0315900_105313594 | 3300031787 | Freshwater | PGSTQERDKEITMADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA |
Ga0315900_110403281 | 3300031787 | Freshwater | QTLKEIVMSDTPKTGTVPMTGAFVKQKHRLAAGEKLNGQTLPPAPKTPKTPA |
Ga0315900_111304242 | 3300031787 | Freshwater | MSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPPAPKTAPGPKTPA |
Ga0315909_100506816 | 3300031857 | Freshwater | MSDKPTPGTVPMTGGAVKQHHRMAAGEKITGQKLPPAPATGPKTPA |
Ga0315904_104125424 | 3300031951 | Freshwater | MSDKPTPGTVPMTGALVKQKHRMAAGDKTNGQTLPPEPKMPKTPA |
Ga0315294_104224211 | 3300031952 | Sediment | QTLKEIVMSDTPKTGTVPMTGAFVKQKHRLAAGEKCDGQTLPAAPATPKTPA |
Ga0315289_113925952 | 3300032046 | Sediment | MSDTPKTGTVPMTGAFVKQKHRLAAGEKCDGQTLPAAPATPKTPA |
Ga0315906_103063151 | 3300032050 | Freshwater | TQERDKEITMADKPKEGTVSMNSAYVKQKHRLAAGEKVDGQSLPPEPKVEKNQA |
Ga0315906_103906261 | 3300032050 | Freshwater | HMDDKPKKNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPEPKTEKNQA |
Ga0315905_108936382 | 3300032092 | Freshwater | MDDQPKKNGTVPMTGAYVKQKHRLAAGEKLDGQSLPPEPKTEKNQA |
Ga0315903_105989902 | 3300032116 | Freshwater | MSDKPTPGTVPMTGGAVKQHHRMAAGEKITGQKLPPPPAMGPKTPA |
Ga0315277_113162952 | 3300032118 | Sediment | MSDQPKNGTVPLDSCCVKQHHRLAAGLPVNGQKLPSAPAAPKTPA |
Ga0315268_113292363 | 3300032173 | Sediment | MKDKPTTGTVPMKGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA |
Ga0316617_1017568142 | 3300033557 | Soil | MADKPSTGTVSLNSAYVKQKHRLAAGEKVDGQSLPPEPKSEKNQ |
Ga0334977_0005056_849_986 | 3300033978 | Freshwater | MADKPTPGTVPMTGALVKQKHRLAAGSKENGQTLPAAPAMPKTPA |
Ga0334994_0580026_4_141 | 3300033993 | Freshwater | MADKPTTGTVPMSGAYVKQKHRLAAGEKLDGQSLPPEPKVEKNQA |
Ga0335003_0377994_267_404 | 3300033995 | Freshwater | MSDKPTPGTVPMTGAFVKQKHRLAAGEKLDGQTLPAAPSTPKTPA |
Ga0334979_0120584_1_114 | 3300033996 | Freshwater | TVPMTGAFVKQKHRLAAGEKLDGQSLPPAPATPKTPA |
Ga0334991_0048656_12_149 | 3300034013 | Freshwater | MSDKPTSGTVPLNSALVPQHHRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0334991_0235419_3_116 | 3300034013 | Freshwater | TVPLNSALVPQHHRMAAGQPVTGQTLPAAPSMPKTPC |
Ga0334991_0268084_366_503 | 3300034013 | Freshwater | MSDKPKTGTVSMAGGDVKQKHRMAAGEKVTGQTLPSAPKSPKTPA |
Ga0334998_0776789_346_483 | 3300034019 | Freshwater | MSDKPNDKQVPMDSAFVKQHHRMAAGQKVDGQKLPAAPTTPKTPA |
Ga0335002_0627146_3_125 | 3300034020 | Freshwater | MMADKPKPGTVPMTGPYVKQKHRMAAGEKVTGQTLPAAPKG |
Ga0334987_0609371_197_334 | 3300034061 | Freshwater | MSDKPTPGTVSLNSPYVKQKHRMAAGEKVTGQTLPAEPKTDKNRA |
Ga0335000_0723102_407_520 | 3300034063 | Freshwater | MTGPYVKQKHRLAAGEKLNGQTLPAAPKTAPGPKTPA |
Ga0334990_0101145_12_149 | 3300034068 | Freshwater | MSDTPKTGTVPMTGALVKQKHRLAAGEKLDGQSLPPVPSMPKTPA |
Ga0335027_0000174_2176_2313 | 3300034101 | Freshwater | MSDKPNNTPVPMTGAFVKQHHRMAAGEKVDGQKLPAAPATPKTPA |
Ga0335030_0221216_560_700 | 3300034103 | Freshwater | MSDKPTPGTVPMAGGAVKQHHRMAAGEKLNGQTLPAAPATGPKTPA |
Ga0335031_0070556_1870_2016 | 3300034104 | Freshwater | MADKPTPGTVPMTGPYVKQKHRLAGGEKLNGQTLPAAPKGATSPKCPA |
Ga0335060_0438397_1_126 | 3300034122 | Freshwater | LTPGTVSLNSPYVKQKHRMAAGEKVTGQTLPAEPKTDKNRA |
Ga0334997_0596702_545_679 | 3300034280 | Freshwater | MSDKPTPGTVPMSGPYVKQKHRLAAGEKLNGQTLPPAPKTAPGPK |
⦗Top⦘ |