NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222715_10018083

Scaffold Ga0222715_10018083


Overview

Basic Information
Taxon OID3300021960 Open in IMG/M
Scaffold IDGa0222715_10018083 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_9D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5338
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (92.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.0566Long. (o)-122.185Alt. (m)Depth (m)29
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031468Metagenome / Metatranscriptome182Y
F033361Metagenome / Metatranscriptome177Y
F100708Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0222715_1001808310F033361AGGAGMLIKCNFADHAYLIADDPIRPKLFKDNSVRFEDPFHVYAEINDETGEIAAVVCTIICKFVPQDEYQIKLVAMGRTEQIEEQLKEREELHGELGVVLCPYSIWSYQKGHGRKLINNLLEVAPVMHPEVDAVITMSPHTETAMKFHLQNGAGIFATNTKCVNYEYEVSDVILH
Ga0222715_1001808311F031468GAGMKITIEVDGADAEELMAMIQRATEAVEKLEAILEEFEDADKV
Ga0222715_100180837F100708AGGVTTTKIDIMTPADKERLSLELERQVKEYVKAGGVVTQCPPRAFTAEEGPKKRFSGGQFDSLTDPTNRDVGAVRPTKNKGQQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.