| Basic Information | |
|---|---|
| Taxon OID | 3300020424 Open in IMG/M |
| Scaffold ID | Ga0211620_10130756 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1079 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_048 | |||||||
| Coordinates | Lat. (o) | -9.4112 | Long. (o) | 66.3281 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016994 | Metagenome / Metatranscriptome | 243 | N |
| F030157 | Metagenome / Metatranscriptome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211620_101307561 | F030157 | N/A | LKLAMEAIQNQGVNILGAGALGNSNTEQTYMVRADSLDTISDTTTVAAIQAAIRGLDALTPDKVTADISSATAADRDMSDTQVA |
| Ga0211620_101307562 | F016994 | AGGAGG | MPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |