NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016994

Metagenome / Metatranscriptome Family F016994

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016994
Family Type Metagenome / Metatranscriptome
Number of Sequences 243
Average Sequence Length 130 residues
Representative Sequence MATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Number of Associated Samples 210
Number of Associated Scaffolds 243

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.67 %
% of genes near scaffold ends (potentially truncated) 39.09 %
% of genes from short scaffolds (< 2000 bps) 77.78 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(20.165 % of family members)
Environment Ontology (ENVO) Unclassified
(70.782 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.066 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.06%    β-sheet: 24.06%    Coil/Unstructured: 51.88%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 243 Family Scaffolds
PF05050Methyltransf_21 23.46
PF04055Radical_SAM 1.23
PF03567Sulfotransfer_2 1.23
PF04378RsmJ 1.23
PF08003Methyltransf_9 0.41
PF02445NadA 0.41
PF06676DUF1178 0.41
PF00011HSP20 0.41
PF05488PAAR_motif 0.41
PF07715Plug 0.41
PF01163RIO1 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 243 Family Scaffolds
COG296123S rRNA A2030 N6-methylase RlmJTranslation, ribosomal structure and biogenesis [J] 1.23
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.41
COG0379Quinolinate synthaseCoenzyme transport and metabolism [H] 0.41
COG4104Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretionIntracellular trafficking, secretion, and vesicular transport [U] 0.41
COG5319Uncharacterized conserved protein, DUF1178 domainFunction unknown [S] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10036934All Organisms → Viruses → Predicted Viral2304Open in IMG/M
3300000117|DelMOWin2010_c10068808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1439Open in IMG/M
3300001344|JGI20152J14361_10101037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.576Open in IMG/M
3300001346|JGI20151J14362_10052599All Organisms → Viruses → Predicted Viral1756Open in IMG/M
3300001347|JGI20156J14371_10156339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.631Open in IMG/M
3300001352|JGI20157J14317_10161397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.684Open in IMG/M
3300001450|JGI24006J15134_10009308All Organisms → cellular organisms → Bacteria4898Open in IMG/M
3300001460|JGI24003J15210_10001173All Organisms → cellular organisms → Bacteria → Proteobacteria11483Open in IMG/M
3300001460|JGI24003J15210_10002694All Organisms → cellular organisms → Bacteria → Proteobacteria7791Open in IMG/M
3300001460|JGI24003J15210_10002888All Organisms → cellular organisms → Bacteria7496Open in IMG/M
3300001460|JGI24003J15210_10070721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1089Open in IMG/M
3300001940|GOS2222_1005878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1836Open in IMG/M
3300002482|JGI25127J35165_1026087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1368Open in IMG/M
3300002483|JGI25132J35274_1019090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1631Open in IMG/M
3300002483|JGI25132J35274_1077599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.689Open in IMG/M
3300003477|nap3_10155780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.556Open in IMG/M
3300004457|Ga0066224_1046719All Organisms → cellular organisms → Bacteria2678Open in IMG/M
3300004460|Ga0066222_1113491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.567Open in IMG/M
3300005432|Ga0066845_10001923All Organisms → cellular organisms → Bacteria → Proteobacteria6754Open in IMG/M
3300005433|Ga0066830_10029933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1088Open in IMG/M
3300005512|Ga0074648_1037908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2287Open in IMG/M
3300005523|Ga0066865_10203176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.743Open in IMG/M
3300005912|Ga0075109_1251148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.534Open in IMG/M
3300005913|Ga0075108_10090346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1129Open in IMG/M
3300006029|Ga0075466_1025584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1878Open in IMG/M
3300006193|Ga0075445_10212217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.673Open in IMG/M
3300006334|Ga0099675_1725017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.528Open in IMG/M
3300006357|Ga0075502_1000637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.861Open in IMG/M
3300006392|Ga0075507_1463379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.693Open in IMG/M
3300006397|Ga0075488_1544525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.533Open in IMG/M
3300006401|Ga0075506_1014882All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300006402|Ga0075511_1141169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.600Open in IMG/M
3300006403|Ga0075514_1023531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.723Open in IMG/M
3300006404|Ga0075515_10067708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1283Open in IMG/M
3300006735|Ga0098038_1043964All Organisms → Viruses → Predicted Viral1629Open in IMG/M
3300006737|Ga0098037_1037476All Organisms → Viruses → Predicted Viral1774Open in IMG/M
3300006749|Ga0098042_1162508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.544Open in IMG/M
3300006916|Ga0070750_10497681All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.500Open in IMG/M
3300007234|Ga0075460_10248961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.593Open in IMG/M
3300007331|Ga0079271_1356392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.951Open in IMG/M
3300007332|Ga0079256_1151532All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.943Open in IMG/M
3300007609|Ga0102945_1042495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.912Open in IMG/M
3300007623|Ga0102948_1061270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1185Open in IMG/M
3300007963|Ga0110931_1103127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.860Open in IMG/M
3300009000|Ga0102960_1060143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1395Open in IMG/M
3300009000|Ga0102960_1066528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1322Open in IMG/M
3300009001|Ga0102963_1335991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.593Open in IMG/M
3300009074|Ga0115549_1166567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.711Open in IMG/M
3300009076|Ga0115550_1150603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.813Open in IMG/M
3300009076|Ga0115550_1200397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.672Open in IMG/M
3300009077|Ga0115552_1088476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1352Open in IMG/M
3300009172|Ga0114995_10088375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1742Open in IMG/M
3300009193|Ga0115551_1148188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1075Open in IMG/M
3300009420|Ga0114994_10613207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.713Open in IMG/M
3300009423|Ga0115548_1056851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1371Open in IMG/M
3300009426|Ga0115547_1081518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1087Open in IMG/M
3300009433|Ga0115545_1209057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.663Open in IMG/M
3300009434|Ga0115562_1098497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1163Open in IMG/M
3300009435|Ga0115546_1119080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.947Open in IMG/M
3300009437|Ga0115556_1069443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1396Open in IMG/M
3300009442|Ga0115563_1076160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1499Open in IMG/M
3300009445|Ga0115553_1245155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.702Open in IMG/M
3300009445|Ga0115553_1252465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.690Open in IMG/M
3300009447|Ga0115560_1024733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2888Open in IMG/M
3300009472|Ga0115554_1039369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2219Open in IMG/M
3300009495|Ga0115571_1152818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.967Open in IMG/M
3300009496|Ga0115570_10133749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1176Open in IMG/M
3300009497|Ga0115569_10038063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2759Open in IMG/M
3300009497|Ga0115569_10261188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.775Open in IMG/M
3300009505|Ga0115564_10357115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.721Open in IMG/M
3300009507|Ga0115572_10650293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.578Open in IMG/M
3300009507|Ga0115572_10650295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.578Open in IMG/M
3300009508|Ga0115567_10175958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1402Open in IMG/M
3300009526|Ga0115004_10462156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.751Open in IMG/M
3300009543|Ga0115099_10049083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1373Open in IMG/M
3300009550|Ga0115013_10214180All Organisms → Viruses → Predicted Viral1159Open in IMG/M
3300009608|Ga0115100_10950026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.522Open in IMG/M
3300009679|Ga0115105_10161985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.627Open in IMG/M
3300009705|Ga0115000_10593595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.690Open in IMG/M
3300009756|Ga0123366_1076896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.527Open in IMG/M
3300009785|Ga0115001_10027664All Organisms → cellular organisms → Bacteria → Proteobacteria3757Open in IMG/M
3300009786|Ga0114999_11048764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.588Open in IMG/M
3300009790|Ga0115012_11455259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.587Open in IMG/M
3300009790|Ga0115012_11833983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.532Open in IMG/M
3300010148|Ga0098043_1089716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.905Open in IMG/M
3300010153|Ga0098059_1082683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1280Open in IMG/M
3300010300|Ga0129351_1185683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.811Open in IMG/M
3300012525|Ga0129353_1638510All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300012919|Ga0160422_10100463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1706Open in IMG/M
3300012919|Ga0160422_10705900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.644Open in IMG/M
3300012920|Ga0160423_10051722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2983Open in IMG/M
3300012920|Ga0160423_10054690All Organisms → Viruses → Predicted Viral2891Open in IMG/M
3300012928|Ga0163110_10013994All Organisms → Viruses → Predicted Viral4566Open in IMG/M
3300012936|Ga0163109_10003800All Organisms → cellular organisms → Bacteria11538Open in IMG/M
3300012936|Ga0163109_10266923All Organisms → Viruses → Predicted Viral1254Open in IMG/M
3300012952|Ga0163180_10055764All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412392Open in IMG/M
3300012953|Ga0163179_10003155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED3711278Open in IMG/M
3300012954|Ga0163111_10126945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2130Open in IMG/M
3300012954|Ga0163111_10296455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1434Open in IMG/M
3300014959|Ga0134299_1028525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.882Open in IMG/M
3300016726|Ga0182045_1271585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.864Open in IMG/M
3300016743|Ga0182083_1102296All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300016747|Ga0182078_10537035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.911Open in IMG/M
3300016754|Ga0182072_1354348All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300017706|Ga0181377_1013512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1909Open in IMG/M
3300017706|Ga0181377_1038593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.955Open in IMG/M
3300017708|Ga0181369_1101671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.597Open in IMG/M
3300017717|Ga0181404_1163863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.534Open in IMG/M
3300017721|Ga0181373_1018337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1305Open in IMG/M
3300017745|Ga0181427_1098337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.715Open in IMG/M
3300017765|Ga0181413_1206151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.586Open in IMG/M
3300017776|Ga0181394_1163513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.687Open in IMG/M
3300017781|Ga0181423_1326683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.561Open in IMG/M
3300017786|Ga0181424_10068636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1531Open in IMG/M
3300017824|Ga0181552_10415742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.642Open in IMG/M
3300017952|Ga0181583_10007017All Organisms → cellular organisms → Bacteria → Proteobacteria8272Open in IMG/M
3300017956|Ga0181580_10294117All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300017958|Ga0181582_10011300All Organisms → cellular organisms → Bacteria → Proteobacteria7178Open in IMG/M
3300017962|Ga0181581_10434832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.820Open in IMG/M
3300017968|Ga0181587_10660169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.663Open in IMG/M
3300018049|Ga0181572_10481494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.766Open in IMG/M
3300018413|Ga0181560_10110833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1446Open in IMG/M
3300018415|Ga0181559_10363264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.799Open in IMG/M
3300018417|Ga0181558_10052710All Organisms → Viruses → Predicted Viral2731Open in IMG/M
3300018423|Ga0181593_10204610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411554Open in IMG/M
3300018428|Ga0181568_10698784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.792Open in IMG/M
3300019025|Ga0193545_10061070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.784Open in IMG/M
3300019282|Ga0182075_1696461All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300020055|Ga0181575_10622636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.560Open in IMG/M
3300020175|Ga0206124_10319263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.589Open in IMG/M
3300020266|Ga0211519_1009149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2606Open in IMG/M
3300020336|Ga0211510_1116570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.606Open in IMG/M
3300020365|Ga0211506_1079034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.930Open in IMG/M
3300020366|Ga0211489_10153785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.639Open in IMG/M
3300020374|Ga0211477_10236774All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.629Open in IMG/M
3300020391|Ga0211675_10043240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2202Open in IMG/M
3300020397|Ga0211583_10223385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.685Open in IMG/M
3300020402|Ga0211499_10011145All Organisms → Viruses → Predicted Viral4072Open in IMG/M
3300020403|Ga0211532_10003168All Organisms → cellular organisms → Bacteria12125Open in IMG/M
3300020403|Ga0211532_10396148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.517Open in IMG/M
3300020404|Ga0211659_10137916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1111Open in IMG/M
3300020414|Ga0211523_10193419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.845Open in IMG/M
3300020418|Ga0211557_10184518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.982Open in IMG/M
3300020424|Ga0211620_10130756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1079Open in IMG/M
3300020428|Ga0211521_10017137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4263Open in IMG/M
3300020430|Ga0211622_10497101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.521Open in IMG/M
3300020436|Ga0211708_10013175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3108Open in IMG/M
3300020436|Ga0211708_10085260All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1229Open in IMG/M
3300020438|Ga0211576_10385243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.719Open in IMG/M
3300020440|Ga0211518_10021910All Organisms → cellular organisms → Bacteria4027Open in IMG/M
3300020440|Ga0211518_10047753All Organisms → Viruses → Predicted Viral2470Open in IMG/M
3300020442|Ga0211559_10364750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.669Open in IMG/M
3300020445|Ga0211564_10007977All Organisms → cellular organisms → Bacteria5254Open in IMG/M
3300020446|Ga0211574_10211039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.843Open in IMG/M
3300020448|Ga0211638_10336913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.703Open in IMG/M
3300020453|Ga0211550_10410066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.636Open in IMG/M
3300020463|Ga0211676_10000236All Organisms → cellular organisms → Bacteria58852Open in IMG/M
3300020463|Ga0211676_10195065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1230Open in IMG/M
3300020469|Ga0211577_10066329All Organisms → cellular organisms → Bacteria2576Open in IMG/M
3300020470|Ga0211543_10467699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.601Open in IMG/M
3300020471|Ga0211614_10016063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3103Open in IMG/M
3300020471|Ga0211614_10019792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2792Open in IMG/M
3300020474|Ga0211547_10069776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411863Open in IMG/M
3300020474|Ga0211547_10129393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1315Open in IMG/M
3300020475|Ga0211541_10478022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.609Open in IMG/M
3300020595|Ga0206126_10439866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.569Open in IMG/M
3300020595|Ga0206126_10445277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.564Open in IMG/M
3300021356|Ga0213858_10038041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2321Open in IMG/M
3300021356|Ga0213858_10044595All Organisms → Viruses → Predicted Viral2142Open in IMG/M
3300021389|Ga0213868_10299122All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.922Open in IMG/M
3300021958|Ga0222718_10006007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED379730Open in IMG/M
3300021959|Ga0222716_10043737All Organisms → cellular organisms → Bacteria3203Open in IMG/M
3300021959|Ga0222716_10157713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1474Open in IMG/M
3300021960|Ga0222715_10072633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2294Open in IMG/M
3300021961|Ga0222714_10499728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.624Open in IMG/M
3300021964|Ga0222719_10131037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411792Open in IMG/M
3300022837|Ga0222711_1000647All Organisms → cellular organisms → Bacteria → Proteobacteria9623Open in IMG/M
3300022842|Ga0222632_1016420All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411301Open in IMG/M
3300022843|Ga0222631_1024894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.867Open in IMG/M
3300022848|Ga0222674_1010392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1709Open in IMG/M
3300022857|Ga0222653_1031415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.949Open in IMG/M
3300022865|Ga0222668_1013787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1538Open in IMG/M
3300022907|Ga0255775_1107056All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300023116|Ga0255751_10229080All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300023117|Ga0255757_10510441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.522Open in IMG/M
3300023231|Ga0222689_1003996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2330Open in IMG/M
3300023237|Ga0222650_1049617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.699Open in IMG/M
3300023296|Ga0222664_1004027All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED413946Open in IMG/M
3300024301|Ga0233451_10190953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.884Open in IMG/M
3300024344|Ga0209992_10117498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1179Open in IMG/M
3300025086|Ga0208157_1042896All Organisms → Viruses → Predicted Viral1248Open in IMG/M
3300025099|Ga0208669_1032509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1266Open in IMG/M
3300025102|Ga0208666_1064393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.984Open in IMG/M
3300025120|Ga0209535_1000832All Organisms → cellular organisms → Bacteria21431Open in IMG/M
3300025120|Ga0209535_1001691All Organisms → cellular organisms → Bacteria14791Open in IMG/M
3300025120|Ga0209535_1002615All Organisms → cellular organisms → Bacteria → Proteobacteria11731Open in IMG/M
3300025120|Ga0209535_1017555All Organisms → cellular organisms → Bacteria → Proteobacteria3724Open in IMG/M
3300025127|Ga0209348_1170035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.629Open in IMG/M
3300025151|Ga0209645_1000805All Organisms → cellular organisms → Bacteria → Proteobacteria16032Open in IMG/M
3300025151|Ga0209645_1008554All Organisms → cellular organisms → Bacteria4220Open in IMG/M
3300025483|Ga0209557_1059534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.923Open in IMG/M
3300025502|Ga0208903_1001580All Organisms → cellular organisms → Bacteria → Proteobacteria12569Open in IMG/M
3300025601|Ga0208768_1167443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.587Open in IMG/M
3300025610|Ga0208149_1001113All Organisms → cellular organisms → Bacteria → Proteobacteria10089Open in IMG/M
3300025630|Ga0208004_1035869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1418Open in IMG/M
3300025637|Ga0209197_1160325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.598Open in IMG/M
3300025666|Ga0209601_1173443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.589Open in IMG/M
3300025685|Ga0209095_1160014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.649Open in IMG/M
3300025696|Ga0209532_1130243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.809Open in IMG/M
3300025699|Ga0209715_1251248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.519Open in IMG/M
3300025704|Ga0209602_1239009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.513Open in IMG/M
3300025712|Ga0209305_1052539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1410Open in IMG/M
3300025751|Ga0208150_1133486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.795Open in IMG/M
3300025769|Ga0208767_1130010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.951Open in IMG/M
3300025771|Ga0208427_1199979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.636Open in IMG/M
3300025803|Ga0208425_1132392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.563Open in IMG/M
3300025816|Ga0209193_1021943All Organisms → Viruses → Predicted Viral2011Open in IMG/M
3300025816|Ga0209193_1141807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.564Open in IMG/M
3300025816|Ga0209193_1145297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.554Open in IMG/M
3300025821|Ga0209600_1057056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1295Open in IMG/M
3300025822|Ga0209714_1186853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.504Open in IMG/M
3300025832|Ga0209307_1120166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.821Open in IMG/M
3300025876|Ga0209223_10299899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.729Open in IMG/M
3300025886|Ga0209632_10312262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.779Open in IMG/M
3300025890|Ga0209631_10145018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1289Open in IMG/M
3300025892|Ga0209630_10145812All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300025894|Ga0209335_10343446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.621Open in IMG/M
3300026097|Ga0209953_1051691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.565Open in IMG/M
3300026136|Ga0208763_1000013All Organisms → cellular organisms → Bacteria → Proteobacteria52102Open in IMG/M
3300026270|Ga0207993_1108504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.744Open in IMG/M
3300027687|Ga0209710_1083239All Organisms → Viruses → Predicted Viral1313Open in IMG/M
3300027859|Ga0209503_10304796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.776Open in IMG/M
3300028194|Ga0257106_1074289All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300028196|Ga0257114_1309929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.542Open in IMG/M
3300029448|Ga0183755_1023354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1979Open in IMG/M
3300030723|Ga0308129_1031766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.576Open in IMG/M
3300030725|Ga0308128_1007166All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300031510|Ga0308010_1057089All Organisms → Viruses → Predicted Viral1585Open in IMG/M
3300031519|Ga0307488_10039336All Organisms → cellular organisms → Bacteria → Proteobacteria3728Open in IMG/M
3300031519|Ga0307488_10130022All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411792Open in IMG/M
3300031519|Ga0307488_10785758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.528Open in IMG/M
3300031602|Ga0307993_1029219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411381Open in IMG/M
3300031644|Ga0308001_10107336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1169Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.16%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine14.81%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.05%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.12%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water3.70%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.47%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.47%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.06%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.23%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.23%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.23%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.23%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.41%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.41%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.41%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine0.41%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.41%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.41%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.41%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.82%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.82%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.82%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001347Pelagic Microbial community sample from North Sea - COGITO 998_met_06EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001940Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300003477Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007331Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 DCM_A metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007332Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 Surf_A metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300014959Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubationEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016743Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020365Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020391Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967)EnvironmentalOpen in IMG/M
3300020397Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)EnvironmentalOpen in IMG/M
3300020402Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020418Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022837Saline water microbial communities from Ace Lake, Antarctica - #1699EnvironmentalOpen in IMG/M
3300022842Saline water microbial communities from Ace Lake, Antarctica - #46EnvironmentalOpen in IMG/M
3300022843Saline water microbial communities from Ace Lake, Antarctica - #5EnvironmentalOpen in IMG/M
3300022848Saline water microbial communities from Ace Lake, Antarctica - #866EnvironmentalOpen in IMG/M
3300022857Saline water microbial communities from Ace Lake, Antarctica - #419EnvironmentalOpen in IMG/M
3300022865Saline water microbial communities from Ace Lake, Antarctica - #728EnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023117Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaGEnvironmentalOpen in IMG/M
3300023231Saline water microbial communities from Ace Lake, Antarctica - #1231EnvironmentalOpen in IMG/M
3300023237Saline water microbial communities from Ace Lake, Antarctica - #367EnvironmentalOpen in IMG/M
3300023296Saline water microbial communities from Ace Lake, Antarctica - #604EnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025502Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes)EnvironmentalOpen in IMG/M
3300025601Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025666Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026097Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026270Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1003693443300000117MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
DelMOWin2010_1006880813300000117MarineEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
JGI20152J14361_1010103713300001344Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDL
JGI20151J14362_1005259933300001346Pelagic MarineMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGSSASTLLAALKALGTVDSIDLNDSGTTAVVNDLEI*
JGI20156J14371_1015633923300001347Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
JGI20157J14317_1016139713300001352Pelagic MarineELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
JGI24006J15134_1000930823300001450MarineMAITENNTTFVAANEELLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
JGI24003J15210_10001173103300001460MarineMATETNTTFTAASTSLLGKELEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGAGPLFDSDASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI*
JGI24003J15210_1000269423300001460MarineMATENNTTFTAASTSLLGKELEFITIDAGEELANHLLKNETANTIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGTFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
JGI24003J15210_1000288853300001460MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
JGI24003J15210_1007072123300001460MarineMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI*
GOS2222_100587823300001940MarineMAITENNTTFVAGTEALLGKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVALAHYSILMLQNIHRRSTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
JGI25127J35165_102608733300002482MarineTIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEL*
JGI25132J35274_101909033300002483MarineMAISENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI*
JGI25132J35274_107759923300002483MarineMPISENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEI*
nap3_1015578013300003477EstuarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGTFTFTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEL*
Ga0066224_104671963300004457MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDKNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI*
Ga0066222_111349113300004460MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI*
Ga0066845_1000192373300005432MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQEKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEI*
Ga0066830_1002993323300005433MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0074648_103790823300005512Saline Water And SedimentMAITENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQTEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM*
Ga0066865_1020317623300005523MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRLYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0075109_125114823300005912Saline LakeMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDS
Ga0075108_1009034633300005913Saline LakeMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL*
Ga0075466_102558443300006029AqueousTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
Ga0075445_1021221713300006193MarineMAITENNTTFVAANEEFLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPAGAGGSFTFTESGADGSAVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0099675_172501713300006334MarineMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKI
Ga0075502_100063723300006357AqueousMAISENNTTFVAANGELLGKDLEFLTIDAGEELANHVAKGGTLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTTQTEGGSASTLLAAIKALGIVDSIDLNDVGTTAVVNDLEM*
Ga0075507_146337913300006392AqueousASQSFKSEKKGGLIMAISENNTTFVAANGELLGKDLEFLTIDAGEELANHVAKGGTLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTTQTEGGSASTLLAAIKALGIVDSIDLNDVGTTAVVNDLEM*
Ga0075488_154452513300006397AqueousMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM*
Ga0075506_101488223300006401AqueousAASQSFKSEKKGGLIMAISENNTTFVAANGELLGKDLEFLTIDAGEELANHVAKGGTLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTTQTEGGSASTLLAAIKALGIVDSIDLNDVGTTAVVNDLEM*
Ga0075511_114116913300006402AqueousNQKKGGLKMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
Ga0075514_102353123300006403AqueousENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM*
Ga0075515_1006770813300006404AqueousKKGGLKMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
Ga0098038_104396433300006735MarineMAISENNTTFVAGNEEFLGKQLEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDAGTTAKI
Ga0098037_103747633300006737MarineMAISENNTTFVSGNEEFLGKQLEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0098042_116250813300006749MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEL*
Ga0070750_1049768113300006916AqueousNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM*
Ga0075460_1024896113300007234AqueousMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM*
Ga0079271_135639223300007331MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTIRQYGNVVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLVTALKALGTIDSIDLNDSGTTAKIENLEL*
Ga0079256_115153213300007332MarineMATENNTTFVAADNSSLLGKELEFITVDAGEELANHQAKNETQNAIENTIRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTETGADGSAVSTLVTALKALGTIDGIDLNDGGTTAKREVLEL*
Ga0102945_104249513300007609Pond WaterMAITENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQTEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM*
Ga0102948_106127023300007623WaterMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDGIDLNDSGTTATINDLAI*
Ga0110931_110312723300007963MarineLIPERNQSHLIRKKGGLKMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0102960_106014313300009000Pond WaterMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM*
Ga0102960_106652813300009000Pond WaterFVAANGSQLGKELEFLTVDAGEELANHLEKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI*
Ga0102963_133599113300009001Pond WaterLIPERYHSHYNQKKGGFKMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI*
Ga0115549_116656713300009074Pelagic MarineLGKELEFLTIDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDSNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115550_115060323300009076Pelagic MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
Ga0115550_120039723300009076Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDSDASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115552_108847613300009077Pelagic MarineENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0114995_1008837523300009172MarineLIPERGHSHYNQKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL*
Ga0115551_114818813300009193Pelagic MarineMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASASTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0114994_1061320723300009420MarineLIPERGHSHYNQKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL*
Ga0115548_105685123300009423Pelagic MarineMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDSNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115547_108151823300009426Pelagic MarineSENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLGALKALGTVDGIDLNDSGTTATINDLEM*
Ga0115545_120905713300009433Pelagic MarineLIPERYHSHYNQKKGGFKMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDSNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEM*
Ga0115562_109849713300009434Pelagic MarineNTTFVAANGSQLGKELEFLTVDAGEELANHTGKAGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115546_111908023300009435Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLTALKALGTVDGIDLNDSGTTATIN
Ga0115556_106944323300009437Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115563_107616023300009442Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115553_124515513300009445Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGASASTLLAALKALGTVDGIDLNDSGTTATINDLAI*
Ga0115553_125246513300009445Pelagic MarineLEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIAEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115560_102473363300009447Pelagic MarineITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLTAALKALGTVDSIDLNDSGTTAKIEDLTI*
Ga0115554_103936933300009472Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLAI*
Ga0115571_115281813300009495Pelagic MarineLIPERDQSHLIRKKGGFKMAITENNTTFVAGTEALLGKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTESGSDGSSVGTLTA
Ga0115570_1013374923300009496Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLTALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115569_1003806313300009497Pelagic MarineSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTLTESGSDGSSVGTLTAALKALGTVDSIDLNDSGTTAKIEDLTI*
Ga0115569_1026118813300009497Pelagic MarineLIPERYHSHYNQKKGGFKMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLTALKALGTVDGIDLNDSGTTAVVNDLEI*
Ga0115564_1035711513300009505Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDSNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115572_1065029313300009507Pelagic MarineIPERYHSHYNQKKGGFKMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI*
Ga0115572_1065029513300009507Pelagic MarineIPERYHSHYNQKKGGFKMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLAI*
Ga0115567_1017595813300009508Pelagic MarineKMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGSSASTLLAALKALGTVDSIDLNDSGTTAVVNDLEI*
Ga0115004_1046215623300009526MarineLIPERGHSHYNQKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDG
Ga0115099_1004908313300009543MarineIIRKKGGLKMAISENNTTFVAGTQSFLGKELEFIMVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI*
Ga0115013_1021418023300009550MarineMAISENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDAGTTAKIENLEI*
Ga0115100_1095002613300009608MarineGIKVIIIRKKGGLKMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI*
Ga0115105_1016198523300009679MarineGIKVIIIRKKGGLKMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI*
Ga0115000_1059359523300009705MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLE
Ga0123366_107689613300009756MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDSNASRTYIVEGTDMFVGAPASAGGTFTFSESGSDGSAVGTLQAALKALGTIDGIDLNDSGTTAKIENLEI*
Ga0115001_1002766433300009785MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL*
Ga0114999_1104876413300009786MarineLAQIVILQHNLPNRSINTFNLIPERGHSHYNQKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL*
Ga0115012_1145525923300009790MarineMAITENNTTFTVASESFLGKELEFITIDAGEELANHLLKGETMNAIENTVRHYGNIVGAGPLFDTNASKTYIVEGTDMFVGGPASSGGSFTFTESGADGSSVGTLLAALKAL
Ga0115012_1183398313300009790MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHQAKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEI*
Ga0098043_108971623300010148MarineLIPERNQSHLIRKKGGLKMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIEDLTI*
Ga0098059_108268333300010153MarineLIPERNQSHLIRKKGGLKMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIEDLTI*
Ga0129351_118568313300010300Freshwater To Marine Saline GradientMAISENNTTFVAANGNQLGKQLEFLTIDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTTQTEGSSASTLLAAIKALGTVDSIDLN
Ga0129353_163851023300012525AqueousMPISENNTTFVAANGELLGKDLEFLTIDAGEELANHLLKGETLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPASAGGSFTLTTQTEGGSASTLLAAIKALGTVDGINLNDGGTTAVVNDLEM*
Ga0160422_1010046333300012919SeawaterGKELEFITIDAGEELANHLLKNETANAIENTVRQFGNIVGSGPLFDTNASRTYIVEGTDMFVGSPATTGTGAFTFTESGADGSSVGTLVTALKALGTIDGIDLNDSGTTAKIENLEL*
Ga0160422_1070590013300012919SeawaterMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL*
Ga0160423_1005172263300012920Surface SeawaterMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL*
Ga0160423_1005469053300012920Surface SeawaterMPISENNTTFVSADNSSLLGKELEFLTIDAGEELANHLLKGETLNAIENTIRQFGNIQGSGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTEQARAGTSATTLLAAIKALGTVDGINLNDGGTTAVVNNLEI*
Ga0163110_1001399433300012928Surface SeawaterMATENNTTFVAAQESLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGSDGSSVGTLLAAIKALGTIDGIDLNDGGTTAKIEDLTI*
Ga0163109_10003800103300012936Surface SeawaterMPASENNTTFVAAQESLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFSESGADGTAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTL*
Ga0163109_1026692333300012936Surface SeawaterVAAQESLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGSDGSSVGTLLAAIKALGTIDGIDLNDGGTTAKIEDLTI*
Ga0163180_1005576433300012952SeawaterLIPERNQSHYNQKKGGLKMATENNTTFTAETGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGTSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI*
Ga0163179_1000315533300012953SeawaterLIPERNQSHYNQKKGGLKMATENNTTFTAETGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDSNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGTSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI*
Ga0163111_1012694513300012954Surface SeawaterAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL*
Ga0163111_1029645523300012954Surface SeawaterMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRLYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEI*
Ga0134299_102852513300014959MarineKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI*
Ga0182045_127158513300016726Salt MarshRQYRYLNQRIRRIKMPISENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDSDASRTYIVEGTDMFVGAPASAGGSFTLTESGADGSAVVTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0182083_110229613300016743Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTTQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0182078_1053703523300016747Salt MarshLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0182072_135434823300016754Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTQQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0181377_101351243300017706MarineSNTTFTVASETFLGKELEFITIDAGEELANHLLKGETMNAIENTVRHYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0181377_103859323300017706MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASKTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0181369_110167113300017708MarineMAISENNTTFVSGNEEFLGKQLEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASSGGAFTFTESGADGSSVGTLTAALKALGTVDGINLNDSGTTAKIENLEI
Ga0181404_116386313300017717SeawaterKVIIIRKKGGLKMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIEN
Ga0181373_101833733300017721MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGTSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0181427_109833723300017745SeawaterMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0181413_120615123300017765SeawaterMAITENNTTFVAGTEALLGKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGT
Ga0181394_116351313300017776SeawaterKMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0181423_132668313300017781SeawaterNTTFVAGTEALLGKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0181424_1006863613300017786SeawaterENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0181552_1041574223300017824Salt MarshMPISENNTTFVADDNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0181583_1000701743300017952Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTAQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0181580_1029411713300017956Salt MarshFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTTQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEI
Ga0181582_1001130083300017958Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGGPATAGGSFTFTEQSEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM
Ga0181581_1043483213300017962Salt MarshMAISENNTTFVAANGNQLGKELEFLIVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0181587_1066016913300017968Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM
Ga0181572_1048149423300018049Salt MarshMPISENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGTFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0181560_1011083333300018413Salt MarshMPISENNTTFVAADQSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDSNASRTYIVEGTDMFVGAPASAGGSFTFSESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0181559_1036326423300018415Salt MarshMPISENNTTFVAADQSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRHYGNIVGAGPLFDSNASRTYIVEGTDMFVGAPASAGGSFTFSESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0181558_1005271013300018417Salt MarshMYCLSDGAGILNQRIRRIKMPISENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGTFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0181593_1020461033300018423Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTV
Ga0181568_1069878413300018428Salt MarshMPISENNTTFVADDNSSLLGKELEFITIDAGEELANHQEKNETQNAIENTVRQYGNIVGAGPLFDSDASRTYIVEGTDMFVGAPASAGGTFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0193545_1006107013300019025MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGAFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI
Ga0182075_169646113300019282Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSIDLNDGGTTAVVNDLEM
Ga0181575_1062263623300020055Salt MarshMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTV
Ga0206124_1031926323300020175SeawaterMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGID
Ga0211519_100914913300020266MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGTFTFTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211510_111657023300020336MarineLGKELEFITIDAGEELANHLLKGETLNAIENTVRIYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPASAGGTFTFTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211506_107903423300020365MarineMPISENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211489_1015378523300020366MarineMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211477_1023677423300020374MarineFLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211675_1004324033300020391MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0211583_1022338513300020397MarineMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKI
Ga0211499_1001114513300020402MarineAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211532_1000316813300020403MarineELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLVAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211532_1039614813300020403MarineELEFITIDAGEELANHQAKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211659_1013791633300020404MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211523_1019341913300020414MarineMPISENNTTFVAADQSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDSNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDGGTTAKIENLEI
Ga0211557_1018451823300020418MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAAIKALGTIDGIDLNDGGTTAKIENLEL
Ga0211620_1013075623300020424MarineMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0211521_1001713713300020428MarineREKGGLKMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0211622_1049710123300020430MarineLEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL
Ga0211708_1001317563300020436MarineMATENNTTFVAADNSSLLGKELEFITVDAGEELANHQAKNETQNAIENTIRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTETGADGSAVSTLVTALKALGTIDGIDLNDGGTTAKREVLEL
Ga0211708_1008526033300020436MarineMASENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTETSSGSSVGTLLAAIKALGTIDSINLNDGGTTASHKTLQLD
Ga0211576_1038524313300020438MarineMAITENNTTFVAANEELLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPAGAGGSFTFTESGADGSSVGTLLAALKALGT
Ga0211518_1002191033300020440MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANTIENTVRLYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211518_1004775313300020440MarineMTTENNTTFVAAADSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGSFTLTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL
Ga0211559_1036475013300020442MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAAIKALGTVDGIDLND
Ga0211564_1000797763300020445MarineMATETNTTFVAATGSLLGKELEFITVDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPATSGTGAFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0211574_1021103923300020446MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQEKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL
Ga0211638_1033691323300020448MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGSFTLTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL
Ga0211550_1041006623300020453MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLVTALKALGTIDSIDLNDSGTTAKIENLEL
Ga0211676_10000236373300020463MarineMAISENNTTFVAGNEEFMGKQLEFITIDAGEELANHLLKNETLNTIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211676_1019506523300020463MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0211577_1006632923300020469MarineMAISENNTTFVAGTQSFLGKELEFITVDAGEELANHLAKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0211543_1046769913300020470MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTLTESGADGSSVGTLVTALK
Ga0211614_1001606323300020471MarineMPASENNTTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGSPATTGTGAFTFTESGADGSSVGTLVTALKALGTIDGIDLNDSGTTAKIENLEL
Ga0211614_1001979263300020471MarineEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPATSGTGAFTFTESGADGSSVGTLVTALKALGTIDSIDLNDSGTTAKRENLEL
Ga0211547_1006977633300020474MarineMAITENNTTFTVASESFLGKELEFITIDAGEELANHLLKGETMNAIENTVRHYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTFTESGADGTSVGTLLAALKALGTVDS
Ga0211547_1012939333300020474MarineTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0211541_1047802223300020475MarineKELEFITIDAGEELANHLLKGETMNAIENTVRHYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPAGAGGAFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI
Ga0206126_1043986613300020595SeawaterMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLTALKALGTVDGIDLN
Ga0206126_1044527713300020595SeawaterMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI
Ga0213858_1003804123300021356SeawaterMAISENNTTFVSADNSSLLGKELEFLTIDAGEELANHLLKGETLNAIENTVRVYGNIVGSGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTEQARAGTSATTLLAAIKALGTVDGINLNDGGTTAVVNNLEI
Ga0213858_1004459533300021356SeawaterMYCLSDGAGILNQRIRRIKMPISENNTTFVADDNSSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRHYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0213868_1029912223300021389SeawaterMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIEDLTI
Ga0222718_1000600743300021958Estuarine WaterMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLEKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI
Ga0222716_1004373773300021959Estuarine WaterMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDGIDLNDSGTTATINDLAI
Ga0222716_1015771313300021959Estuarine WaterKGGFKMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI
Ga0222715_1007263323300021960Estuarine WaterMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI
Ga0222714_1049972823300021961Estuarine WaterKMAISENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDGIDLNDSGTTATINDLAI
Ga0222719_1013103733300021964Estuarine WaterMAISENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESSAGGSASTLLAAIKALGTVDGIDLNDSGTTATINDLAI
Ga0222711_1000647113300022837Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222632_101642013300022842Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPAGAGGSFTLTESGADGTSVGTLLAALKALGTVDGINLNDSGTTAK
Ga0222631_102489423300022843Saline WaterMATETNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222674_101039223300022848Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPAGAGGSFTLTESGADGTSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0222653_103141523300022857Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222668_101378713300022865Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0255775_110705613300022907Salt MarshMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALGTVDSI
Ga0255751_1022908013300023116Salt MarshMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGGPATAGGSFTFTEQSEGGSASTLLAAIKALGTVDGIDLNDGGTTAVV
Ga0255757_1051044123300023117Salt MarshNQLGKQLEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGGPATAGGSFTFTEQSEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM
Ga0222689_100399613300023231Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222650_104961713300023237Saline WaterCNLIPERGHSHYNQKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222664_100402753300023296Saline WaterMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTFTESGADGTSVGTLLAALKALGTVDGIDLNDSSTTAKIENLEL
Ga0233451_1019095313300024301Salt MarshKELEFITIDAGEELANHQLKNETQNAIENTVRQYGNIVGAGLLFDSDASRTYIVEGTDMFVGAPASAGGSFTLTESGADGSAVGTLQAALKALGTIDGIDLNDSGTTAKIEDLTI
Ga0209992_1011749833300024344Deep SubsurfaceMATENNTTFVAGTQSFLGKELEFITIDAGEELANHQLKNETQNAIENTVRQFGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0208157_104289613300025086MarineMAISENNTTFVSGNEEFLGKQLEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASKTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGT
Ga0208669_103250933300025099MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGINLNDSGTTAKIENLEI
Ga0208666_106439323300025102MarineMAISENNTTFVAGTQSFMGKEFEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGGPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209535_100083283300025120MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPAGAGGTFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209535_1001691103300025120MarineMATETNTTFTAASTSLLGKELEFITIDAGEELANHLLKNETANTIENTVRVYGNIVGAGPLFDSDASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI
Ga0209535_1002615103300025120MarineMATENNTTFTAASTSLLGKELEFITIDAGEELANHLLKNETANTIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGTFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209535_101755523300025120MarineMATENNTTFTAETGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEI
Ga0209348_117003513300025127MarineTFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSAVGTLQAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209645_1000805173300025151MarineMAISENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209645_100855493300025151MarineFVAADNSSLLGKELEFITIDAGEELANHQAKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEI
Ga0209557_105953423300025483MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTSASKTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0208903_100158093300025502Saline LakeMATETNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0208768_116744323300025601Saline LakeFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSSTTAKIENLEL
Ga0208149_100111393300025610AqueousMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGSFTLTESGADGSSVGTLLAALKALGTVDSIDLNDSGTTAKIENLEI
Ga0208004_103586923300025630AqueousMAISENNTTFVAANGELLGKDLEFLTIDAGEELANHVAKGGTLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTTQTEGGSASTLLAAIKALGIVDSIDLNDVGTTAVVNDLEM
Ga0209197_116032513300025637Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209601_117344323300025666Pelagic MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLTAALKALGT
Ga0209095_116001413300025685Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLTALKALGTVDGIDLNDSGTTATINDLAI
Ga0209532_113024313300025696Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEM
Ga0209715_125124823300025699Pelagic MarineENNTTFTAASESLLGKELEFITIDAGEELANHLAKNETANAIENTVRQYGNIVGAGPLFDTDASRTYMVEGTDMFVGAPASAGGSFTLTESGADGSSVGTLLAAIKALGTVDGINLNDGGTTAKIENLEI
Ga0209602_123900913300025704Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLTALKALGTVDGIDLNDSGTTATINDLEI
Ga0209305_105253923300025712Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGASASTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0208150_113348613300025751AqueousMAISENNTTFVAANGNQLGKQLEFLTIDAGEELANHVAKGGTLNAIENTIRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTLTTQTEGGSASTLLAAIKALGIVDSIDLNDVGTTAVVNDLEM
Ga0208767_113001023300025769AqueousMPISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTAGGSASTLLAAIKALGTVDS
Ga0208427_119997913300025771AqueousMAISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKGGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGSSAGLYGAFTFTEQSEGGSASTLLAAIKAL
Ga0208425_113239213300025803AqueousMPISENNTTFVAANGNQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQSEGGSASTLLAAIKALG
Ga0209193_102194333300025816Pelagic MarineMPISENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGSSASTLLAALKALGTVDSIDLNDSGTTAVVNDLEI
Ga0209193_114180713300025816Pelagic MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDSIDLNDSGT
Ga0209193_114529713300025816Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEM
Ga0209600_105705623300025821Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209714_118685313300025822Pelagic MarineMATENNTTFVAANGSQLGKELEFLTIDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209307_112016613300025832Pelagic MarineLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTLTESGSDGSSVGTLTAALKALGTVDSIDLNDSGTTAKIEDLTI
Ga0209223_1029989913300025876Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTDASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209632_1031226223300025886Pelagic MarineMAISENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGGSAATLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209631_1014501823300025890Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAESTEGASAGTLLAALKALGTVDGIDLNDSGTTATINDLEI
Ga0209630_1014581233300025892Pelagic MarineGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGSFTLTESGSDGSSVGTLTAALKALGTVDSIDLNDSGTTAKIEDLTI
Ga0209335_1034344613300025894Pelagic MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHTGKDGTLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPGTFAEQAEGSSASTLLAALKALGTVDSIDLNDSGTTAVVNDLEI
Ga0209953_105169113300026097Pond WaterMAITENNTTFVAANGNQLGKELEFLTVDAGEELANHTAKGETLQAIEQTIMAYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTEQTEGGSASTLLAAIKALGTVDGIDLNDGGTTAVVNDLEM
Ga0208763_1000013653300026136MarineMATENNTTFVAADNSSLLGKELEFITIDAGEELANHQEKNETQNAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEI
Ga0207993_110850423300026270MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRLYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGSSVGTLTAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0209710_108323923300027687MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTFTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0209503_1030479623300027859MarineMAISENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAIENTVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGAPASAGGAFTFTESGADGSSVGTLTAALKALGTVDGIDLNDAGTTAKIENLEI
Ga0257106_107428923300028194MarineMAITENNTTFVAANEELLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0257114_130992923300028196MarineMATENNTTFVAANGSQLGKELEFLTVDAGEELANHLAKGETLQAIEQTIMAYGNIVGAGPLFDSNASKTYIVEGTDMFVGAPGTFAESTAGGSAATLLTALKALGTVDGID
Ga0183755_102335433300029448MarineMATENNTTFVAGTQSFLGKELEFITIDAGEELANHLLKNETANAXXXXVRVYGNIVGSGPLFDTNASRTYIVEGTDMFVGSPASSGGTFTFTESGADGSSVGTLLAALKALGTIDSIDLNDSGTTAKIENLEL
Ga0308129_103176623300030723MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0308128_100716613300030725MarineKKGGFKMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGTFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0308010_105708923300031510MarineMAITENNTTFVAANEEFLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPAGAGGSFTFTESGADGSAVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI
Ga0307488_1003933633300031519Sackhole BrineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0307488_1013002223300031519Sackhole BrineMAITENNTTFVAANEELLGKQLEFITIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASAGGSFTFTESGADGSSVGTLLAALKALGTIDGIDLNDSGTTAKIENLEI
Ga0307488_1078575823300031519Sackhole BrineEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDSDASRTYIVEGTDMFVGSPAGAGGSFTLTESGADGSSVGTLLAALKALGTVDGINLNDSGTTAKIENLEL
Ga0307993_102921933300031602MarineMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASRTYIVEGTDMFVGAPASSGGSFTLTESGADGTSVGTLLAALKALGTVDGIDLNDSGTTAKI
Ga0308001_1010733633300031644MarineIDAGEELANHLLKNETLNAIENTVRVYGNIVGAGPLFDTNASKTYIVEGTDMFVGSPAGAGGSFTFTESGADGSAVGTLLAALKALGTVDGIDLNDSGTTAKIENLEI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.