Basic Information | |
---|---|
Taxon OID | 3300020181 Open in IMG/M |
Scaffold ID | Ga0196958_10069425 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1122 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 33.3049 | Long. (o) | -116.2547 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050445 | Metagenome | 145 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0196958_100694253 | F050445 | GAG | MSPQARAALAWKFVFAIAAIAAPVVAYVVTALLVEGRAKEEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLQLELAGRRLDDRSMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGESTGADLKNTAGSLAAGFTALIVSALVGTKQIAK |
⦗Top⦘ |