NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F050445

Metagenome Family F050445

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050445
Family Type Metagenome
Number of Sequences 145
Average Sequence Length 157 residues
Representative Sequence MSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAE
Number of Associated Samples 122
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.14 %
% of genes near scaffold ends (potentially truncated) 16.55 %
% of genes from short scaffolds (< 2000 bps) 46.21 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.310 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.586 % of family members)
Environment Ontology (ENVO) Unclassified
(42.069 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.034 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 65.59%    β-sheet: 0.00%    Coil/Unstructured: 34.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.127.1.0: automated matchesd3c8ta_3c8t0.61361
a.127.1.1: L-aspartase/fumarased1dofa_1dof0.60702
a.127.1.0: automated matchesd3bhga_3bhg0.60401
f.5.1.0: automated matchesd3pika_3pik0.59453
f.5.1.1: Outer membrane efflux proteins (OEP)d1ek9a_1ek90.59215


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF09723Zn-ribbon_8 21.38
PF03816LytR_cpsA_psr 14.48
PF00480ROK 4.14
PF00587tRNA-synt_2b 4.14
PF06224HTH_42 1.38
PF09334tRNA-synt_1g 1.38
PF14572Pribosyl_synth 1.38
PF08544GHMP_kinases_C 1.38
PF14693Ribosomal_TL5_C 1.38
PF08281Sigma70_r4_2 1.38
PF03129HGTP_anticodon 1.38
PF01569PAP2 1.38
PF00590TP_methylase 1.38
PF14018DUF4234 1.38
PF00501AMP-binding 0.69
PF00582Usp 0.69
PF02866Ldh_1_C 0.69
PF13635DUF4143 0.69
PF13556HTH_30 0.69
PF01674Lipase_2 0.69
PF00440TetR_N 0.69
PF13397RbpA 0.69
PF02541Ppx-GppA 0.69
PF06724DUF1206 0.69
PF00378ECH_1 0.69
PF05656DUF805 0.69
PF01026TatD_DNase 0.69
PF00589Phage_integrase 0.69
PF00180Iso_dh 0.69
PF04266ASCH 0.69
PF10011DUF2254 0.69
PF02776TPP_enzyme_N 0.69
PF00268Ribonuc_red_sm 0.69
PF13456RVT_3 0.69
PF02575YbaB_DNA_bd 0.69
PF00999Na_H_Exchanger 0.69
PF02629CoA_binding 0.69
PF00487FA_desaturase 0.69
PF07690MFS_1 0.69
PF00254FKBP_C 0.69
PF01544CorA 0.69
PF13231PMT_2 0.69
PF13193AMP-binding_C 0.69
PF02559CarD_CdnL_TRCF 0.69
PF02770Acyl-CoA_dh_M 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG1316Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase)Cell wall/membrane/envelope biogenesis [M] 14.48
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 8.28
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 1.38
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 1.38
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.38
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 1.38
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.69
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 0.69
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.69
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.69
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.69
COG0718DNA-binding nucleoid-associated protein YbaB/EfbCTranscription [K] 0.69
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.69
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.69
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.69
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.69
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.69
COG3152Uncharacterized membrane protein YhaH, DUF805 familyFunction unknown [S] 0.69
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.69
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.69
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.69
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.31 %
UnclassifiedrootN/A0.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_107317074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300003267|soilL1_10106437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1133Open in IMG/M
3300005178|Ga0066688_10061499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2204Open in IMG/M
3300005327|Ga0070658_10046424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3515Open in IMG/M
3300005329|Ga0070683_100211413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1843Open in IMG/M
3300005329|Ga0070683_100791705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium909Open in IMG/M
3300005331|Ga0070670_100145692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300005332|Ga0066388_104252943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300005335|Ga0070666_10062019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2532Open in IMG/M
3300005337|Ga0070682_100001099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei15526Open in IMG/M
3300005338|Ga0068868_100004286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei9989Open in IMG/M
3300005343|Ga0070687_100392220All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300005344|Ga0070661_100000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales220455Open in IMG/M
3300005344|Ga0070661_100754187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300005347|Ga0070668_100463938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1091Open in IMG/M
3300005347|Ga0070668_101220020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300005354|Ga0070675_100000131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales45094Open in IMG/M
3300005365|Ga0070688_100000022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales71190Open in IMG/M
3300005455|Ga0070663_100994938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium729Open in IMG/M
3300005456|Ga0070678_100177238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1742Open in IMG/M
3300005535|Ga0070684_100559595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300005543|Ga0070672_100000058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales49964Open in IMG/M
3300005544|Ga0070686_100121086All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300005547|Ga0070693_100925163All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005548|Ga0070665_100075170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3385Open in IMG/M
3300005578|Ga0068854_100000273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales34810Open in IMG/M
3300005616|Ga0068852_100428779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1305Open in IMG/M
3300005834|Ga0068851_10000559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales16200Open in IMG/M
3300005834|Ga0068851_10012653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3983Open in IMG/M
3300005840|Ga0068870_10038329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2474Open in IMG/M
3300005844|Ga0068862_100376814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1322Open in IMG/M
3300006237|Ga0097621_100854725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300006755|Ga0079222_11738991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300006794|Ga0066658_10000196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales21886Open in IMG/M
3300009098|Ga0105245_10000365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales42328Open in IMG/M
3300009098|Ga0105245_10090916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2808Open in IMG/M
3300009101|Ga0105247_10270882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1168Open in IMG/M
3300009148|Ga0105243_10025821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4492Open in IMG/M
3300009177|Ga0105248_10000134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales86132Open in IMG/M
3300009789|Ga0126307_10190047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1647Open in IMG/M
3300009840|Ga0126313_10003177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9407Open in IMG/M
3300009840|Ga0126313_10215255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1479Open in IMG/M
3300010036|Ga0126305_10000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales46328Open in IMG/M
3300010037|Ga0126304_10047708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2591Open in IMG/M
3300012892|Ga0157294_10055087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300012893|Ga0157284_10000119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11752Open in IMG/M
3300012899|Ga0157299_10158661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300012901|Ga0157288_10058805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium923Open in IMG/M
3300012902|Ga0157291_10161135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300012905|Ga0157296_10185142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300012908|Ga0157286_10012499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1696Open in IMG/M
3300012909|Ga0157290_10001989All Organisms → cellular organisms → Bacteria3125Open in IMG/M
3300012915|Ga0157302_10176146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300012939|Ga0162650_100000385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3599Open in IMG/M
3300012955|Ga0164298_10202451Not Available1162Open in IMG/M
3300012955|Ga0164298_10259053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1054Open in IMG/M
3300012958|Ga0164299_10971362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300012960|Ga0164301_10000015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales52759Open in IMG/M
3300012960|Ga0164301_10000131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria19264Open in IMG/M
3300012961|Ga0164302_10000031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales28646Open in IMG/M
3300013105|Ga0157369_10000130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales108193Open in IMG/M
3300013297|Ga0157378_10068679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3178Open in IMG/M
3300013307|Ga0157372_10000770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales34695Open in IMG/M
3300014326|Ga0157380_10000273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales31035Open in IMG/M
3300014326|Ga0157380_10996345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300014487|Ga0182000_10024717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1623Open in IMG/M
3300014969|Ga0157376_10383574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1354Open in IMG/M
3300015201|Ga0173478_10269702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300015372|Ga0132256_101838133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300015374|Ga0132255_100958246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1282Open in IMG/M
3300017965|Ga0190266_10068467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1338Open in IMG/M
3300018073|Ga0184624_10000059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales26150Open in IMG/M
3300018465|Ga0190269_10000047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales50255Open in IMG/M
3300018465|Ga0190269_10105341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1389Open in IMG/M
3300018465|Ga0190269_10345099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300018476|Ga0190274_13133439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300018481|Ga0190271_10220489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1907Open in IMG/M
3300018920|Ga0190273_10000611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales13055Open in IMG/M
3300018920|Ga0190273_10132813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300018920|Ga0190273_10770352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300018920|Ga0190273_10911404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300018920|Ga0190273_10934516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300018920|Ga0190273_12193517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300020005|Ga0193697_1067898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium876Open in IMG/M
3300020181|Ga0196958_10060033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1194Open in IMG/M
3300020181|Ga0196958_10069425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1122Open in IMG/M
3300021363|Ga0193699_10113877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1099Open in IMG/M
3300022880|Ga0247792_1019580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1118Open in IMG/M
3300022883|Ga0247786_1007477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2011Open in IMG/M
3300022899|Ga0247795_1000129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11825Open in IMG/M
3300022910|Ga0247768_1059693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300023062|Ga0247791_1003402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2329Open in IMG/M
3300023070|Ga0247755_1000007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria179552Open in IMG/M
3300023071|Ga0247752_1015723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1053Open in IMG/M
3300023077|Ga0247802_1000825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3015Open in IMG/M
3300023077|Ga0247802_1005776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1524Open in IMG/M
3300023266|Ga0247789_1062004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300023275|Ga0247776_10000237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales12579Open in IMG/M
3300024187|Ga0247672_1027397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300024426|Ga0196960_10000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales48725Open in IMG/M
3300024426|Ga0196960_10009464All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300025321|Ga0207656_10000114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales30841Open in IMG/M
3300025321|Ga0207656_10007554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3965Open in IMG/M
3300025900|Ga0207710_10341949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300025909|Ga0207705_10040708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3334Open in IMG/M
3300025918|Ga0207662_10226648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1219Open in IMG/M
3300025920|Ga0207649_10000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria356179Open in IMG/M
3300025926|Ga0207659_10000014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia168481Open in IMG/M
3300025927|Ga0207687_10000011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia388349Open in IMG/M
3300025927|Ga0207687_10003353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales10825Open in IMG/M
3300025935|Ga0207709_10017589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3991Open in IMG/M
3300025940|Ga0207691_10000284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales49983Open in IMG/M
3300025941|Ga0207711_10000024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria293596Open in IMG/M
3300025944|Ga0207661_10206497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1729Open in IMG/M
3300025972|Ga0207668_10740552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300025972|Ga0207668_11064005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300025981|Ga0207640_10000128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales57474Open in IMG/M
3300026023|Ga0207677_10000497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales25525Open in IMG/M
3300026121|Ga0207683_10043956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3904Open in IMG/M
3300026142|Ga0207698_10035539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3647Open in IMG/M
3300026325|Ga0209152_10000384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20899Open in IMG/M
3300026331|Ga0209267_1026699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2815Open in IMG/M
3300028379|Ga0268266_10000303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales78632Open in IMG/M
3300028380|Ga0268265_10550220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1095Open in IMG/M
3300028712|Ga0307285_10000011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales92660Open in IMG/M
3300028722|Ga0307319_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria275261Open in IMG/M
3300028754|Ga0307297_10002104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4758Open in IMG/M
3300028768|Ga0307280_10000016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia67933Open in IMG/M
3300028778|Ga0307288_10000001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia856047Open in IMG/M
3300028782|Ga0307306_10000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales27398Open in IMG/M
3300028802|Ga0307503_10000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia407464Open in IMG/M
3300028872|Ga0307314_10039330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1154Open in IMG/M
3300031152|Ga0307501_10009637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1570Open in IMG/M
3300031938|Ga0308175_100000066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia86099Open in IMG/M
3300032080|Ga0326721_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia320570Open in IMG/M
3300032126|Ga0307415_100006922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6158Open in IMG/M
3300032205|Ga0307472_100017856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3797Open in IMG/M
3300034000|Ga0334918_001360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4696Open in IMG/M
3300034000|Ga0334918_013964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1096Open in IMG/M
3300034005|Ga0334930_002195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3061Open in IMG/M
3300034131|Ga0334911_002446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2323Open in IMG/M
3300034132|Ga0334915_000002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales150818Open in IMG/M
3300034136|Ga0334933_041496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300034173|Ga0334925_001168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6799Open in IMG/M
3300034687|Ga0334905_000064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales13812Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.14%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.45%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.76%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust2.76%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.76%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil2.07%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.38%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020181Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022910Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024426Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034000Biocrust microbial communities from Mojave Desert, California, United States - 14HMCEnvironmentalOpen in IMG/M
3300034005Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNSEnvironmentalOpen in IMG/M
3300034131Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMSEnvironmentalOpen in IMG/M
3300034132Biocrust microbial communities from Mojave Desert, California, United States - 11HMCEnvironmentalOpen in IMG/M
3300034136Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 29HNSEnvironmentalOpen in IMG/M
3300034173Biocrust microbial communities from Mojave Desert, California, United States - 21HNCEnvironmentalOpen in IMG/M
3300034687Soil microbial communities from Mojave Desert, California, United States - 1NOCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10731707423300000956SoilMSKQARAALVGKFAFAIGAIVAPVAAYLVTALLVDGHAKEEYFEAVSQILPVLLLALAIEQRYFTQRRPAPESPLQLELAGYRLDDRSMAKWYTLAARIYALVVLIVLGLGEWIAVEVLATGESSSADLKNTAGSLAAGFTALIVSALVGTKQTND*
soilL1_1010643723300003267Sugarcane Root And Bulk SoilVISESLERSRRLFWFGRFLLALGAILLPIVAYGLTGLLVEGRANEQYFDAVSQILPVLLLALAIEQRYFTRLQSMPDLPPQLEFDEAEVRDFARWYTRAARIYALMVLFILGFGEWVAVEALATGESSSADLQNTAGSLAAGFTALIVSALAGTKQSAD*
Ga0066688_1006149923300005178SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYVVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGQERAPESPLQLELAGRRLDDATMARWYTLAARVYALVVLVLLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSSR*
Ga0070658_1004642433300005327Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAE*
Ga0070683_10021141323300005329Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAFLIAALLVEGEARNEYFDAVSQILPVLLLALAIEQRYFTRAGREPAPESPLQLELAGRRLDDRTMARWYTLAARIYALVVLIVLGLGEWVAVEVLATGESSSGDLSITAGSLAAGFTALIVSALVGTKQTSA*
Ga0070683_10079170513300005329Corn RhizosphereVAASAARVRRRCDPPRRDLGEPGAFAAPLLAGEIPFALGAILLPPVAYGLTALLVDGHARKEYFEAVSQILPVLLLALAVEQRYFTRRQSMPDLPPELEFGEVEIKRLARWYTLAARTYALMVLIALGLGEWIAVEALATGHSTGADLENTAGSLAAGFTALIVSALVGTKTTRAD*
Ga0070670_10014569233300005331Switchgrass RhizosphereVIPENLERARRAFWLGRTLLALSAILLPIAVFIVVGMLVEGHAKDEYFEAVSQILPVLLLALAIEQRYFTRRQALPDLPPELQFAEKEVKKLARWYTLAAQLYALMVLLVLGLGEWVAVEVLATGTSDQDN
Ga0066388_10425294313300005332Tropical Forest SoilEQRLGLLGVEVERRERVEVRLEAGRLDRGLSGSMSSQVRVGLFWRFAFGVGAIVAPVIAYVAVALVVDGQAQKEYFEAISQILPVLLLALAIEQRYFTRLQPIPDFPPELQFAEREVKKMTRWYGVAARVYALLVLLVLGLGEWVAVEVLATGRSSGDNLKFTAGSLAAGFTALIVSALIGTKRTGD*
Ga0070666_1006201933300005335Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRVRAPESPLQLELAGRRLDVRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAE*
Ga0070682_10000109933300005337Corn RhizosphereMSSQVRGGLFWRFAFGVGAIAAPVVAYVVTALVVDGHAKKEYFEAISQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRAMARWYTRAARAYALVVLAALGLGEWIAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKAGRAE*
Ga0068868_10000428683300005338Miscanthus RhizosphereVISENVARSRRFFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEDETRQLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTTADLKNTAGSLAAGFTALIVTALLGTRQTNQPV*
Ga0070687_10039222013300005343Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVLAYAVAALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSAADLKNTAGSLAAGFTALIVSAVVGTKQSAE*
Ga0070661_100000005353300005344Corn RhizosphereVISESVARSRRLFWLGRSLLALSAILLPVVAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPELPAELQFGEAEERSLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTSADLKNTAGSLAAGFTALIVTALIGTKRTGD*
Ga0070661_10075418723300005344Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAFLIAALLVEGEARNEYFDAVSQILPVLLLALAIEQRYFTRAGREPAPESPLQLELAGRRLDDRTMARWYTLAARIYALVVLIVLGLGEWVAVEVLATGESSSGDLSITAGSLAAGFTALIVTALVGTKQIAD*
Ga0070668_10046393823300005347Switchgrass RhizosphereVIPENLERARRLFWLGRTLLALSAILLPVVAYGLAALLVDGIAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPELPPELQFGEAEVKGLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSTTADLKNTAGSLAAGFTALIVTALVGTKQAAD*
Ga0070668_10122002013300005347Switchgrass RhizosphereLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPELPAELQFGEAETRQLARWYTRAGRVYALLVLLALGFGEWIAVEVLATGSSSTADLEKTAGSLAAGFTALIVSALVGTKQTAE*
Ga0070675_100000131353300005354Miscanthus RhizosphereMSSEVQVGLVWRFAFGVGAIAAPVVAYAVTALLVGGHARKEYFEAVSQILPVLLLALAIEQRYFDRAGSEPAPESPLQLELGGRRLDDRTMARWYTFAARAYALVVLFLLGFGEWIAVEVLATGSSTTSDLKNTAGSLAAGFTALIVSALVGTKRTASR*
Ga0070688_100000022513300005365Switchgrass RhizosphereVISESVARSRRLFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAETRQLARWYTRAARLYALLVLIALGLGEWIAVEVLAEGASTTADLKNTAGSLAAGFTALIVTALIGTKQTSS*
Ga0070663_10099493813300005455Corn RhizosphereWLGKFLLAVGAIVLPVFAYFLARLVVEGEAKEQYFEAVSQILPVLLLALAIEQRYFSRSQSIPDLPEELEFGEVEIGKLNRLYAVSARIYALTVLLMLGFGEWIAVEVLATGQSSTADLKRTAGSLAAGFTALMISAVVGTKRTGD*
Ga0070678_10017723833300005456Miscanthus RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVVAYAVTALLVDGHAKQEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLRLELAGRRFDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQSAE*
Ga0070684_10055959523300005535Corn RhizosphereVISESLERSRRLFWLGKSLFALGAILLPPVAYGLTALLVDGHARKEYFEAVSQILPVLLLALAVEQRYFTRRQSMPDLPPELEFGEVEIKRLARWYTLAARTYALMVLIALGLGEWIAVEALATGHSTGADLENTAGSLAAGFTALIVSALVGTKTTRAD*
Ga0070672_100000058263300005543Miscanthus RhizosphereVITESVVRSRQLFWLGRSLLALSAILLPVLAYGLAALLVDGHAEKEYFEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAEMRKLARWYTRAARTYALLVLIALGLGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKQTGG*
Ga0070686_10012108623300005544Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRVRAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAE*
Ga0070693_10092516313300005547Corn, Switchgrass And Miscanthus RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGASSTADLKNTAGSLAAGFTALIVSAL
Ga0070665_10007517033300005548Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSAVVGTKQTSE*
Ga0068854_100000273303300005578Corn RhizosphereMSSQVRVGLFWRFAFGVAAIAAPVVAYVVIALVVDGHAQKEYFEAISQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGKQLVDEQRMARWYTLAARIYALVVLALLGMGEWISVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKAGRAE*
Ga0068852_10042877923300005616Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAFAVAALLVDGTAKDGYFDAVSQILPVLLLALAIEQRYFTRAGSEAAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLVVLGLGEWVAVEVLATGESSSGDRSITAGSLAAGFTALIVSALVGTKQPGN*
Ga0068851_10000559193300005834Corn RhizosphereVIPENLRQARRLFWLGKTLLALSAILLPVVAYGLAPLLVEGHAQKEYFEAVSQILPVLLLALAIEQRYFTRRQSMPEFPPELDFNEAETRDLARWYTRAARIYALMVLVALGLGEWTAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKAERTD*
Ga0068851_1001265353300005834Corn RhizosphereLDRRLSRPVSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLGLAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAD*
Ga0068870_1003832923300005840Miscanthus RhizosphereMSSEVRVSLVWRFAFGVGAIAAPVIAFVVAALAVEGTAQKEYFDAVSQILPVLLLALAIEQRYFTQAGQERAPESPLQMELAGRRLDDRTMARWYALAARIYALVVLIVLGLGEWVAVEVLATGQSSTGDLSITAGSLAAGFTALIVSALVGTKQTGH*
Ga0068862_10037681433300005844Switchgrass RhizosphereVITETVAESVVRSRRLFWLGRSLLALSAILLPVVAYVLAALLVDGHARKEYFEAVSQILPVLLLALAIEQRYFARGHSMPDLPPELQFGEAEMRSLARWYTRAGRIYALLVLIALGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIITALVGTKASQAE*
Ga0097621_10085472513300006237Miscanthus RhizosphereVISESVARSRRLFWLGRSLLALSAILLPVVAYGLAALLVDGHAQKEYYEAISQILPVLLLALAIEQRYFTRGQSMPTLPPELQFGEAETRQLARWYTRAARLYALLVLIALGFGEWIAVEVLATGESSTADLKNTAGSLAAGFTALIVTALVGTRSERN*
Ga0079222_1173899123300006755Agricultural SoilGRLDRRLSRPMSSEVRVGLVWRFAFGVGAIAAPVIAYAVTALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQRAD*
Ga0066658_10000196113300006794SoilVIDENLERARRLFWLGKTLLALSAILLPIVAYLFAALLVDGTAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPEFPPDLDFNPAETRRLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSTTADLKNTAGSLAAGFTALIVTALVGTKQTAE*
Ga0105245_1000036533300009098Miscanthus RhizosphereVIPENLERARRLFWLGKAAVLLGAVVVPFFVFVATMALVDGHAAKEYFEAVSQILPVLLLALAVEQRYFTSSQSMPELPPGLDFNEADSKRVTRLYAFTARLYALSVLFALGLGEWIAVEVLATGESSTTDLKATAGSLAAGFTALIVSALVGTKRER*
Ga0105245_1009091633300009098Miscanthus RhizosphereVIPENLRQARRLFWLGRTLLALSAILLPVVAYGLATLLVEGHAQKEYFEAVSQILPVLLLALAIEQRYFTRRQSMPEFPPELDFNEAETRDLARWYTRAARIYALMVLVALGLGEWTAVEVLATGHSSTADLKNTAGSLAAGFVALIVSALVGTKAEPAE*
Ga0105247_1027088223300009101Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAYAVTALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAE*
Ga0105243_1002582133300009148Miscanthus RhizosphereMALSAILLPIVAYLLAALLVDGTAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPEFPPDLDFNPAETRSLARWYTRAARVYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFTALIVTALVGTRSVDNA*
Ga0105248_10000134253300009177Switchgrass RhizosphereMIPENLQRARRLFWLGKAGVLVGAAAVPAFAFLIAMALVDGHAREEYFEAVSQILPVLLLALAIEQRYFTSSQAMPELPAELEFGNDEIERIARLYAFTARVYALVVLFALGLGEWIAVEVLAAGSSSSTDLKITAGSLAAGFSALIVTALVGTKRER*
Ga0126307_1019004723300009789Serpentine SoilMSSEVRVSLIWRFAFGVAAIAAPVLAYAVAVLLVEGHAAKEYFEAVSQILPVLLLALAIEQRYFTRQPPSAPESPLQLELAGRRLDDRSMARWYTLAARIYALVVLFALGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQAK*
Ga0126313_10003177113300009840Serpentine SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYVVTALVVGGHAQKEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLRLELAGRRLDDRSMARWYTLAARVYALVVLIVLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKMDRSA*
Ga0126313_1021525533300009840Serpentine SoilVIPENLERARRLFWLGRTLLALSAILLPVLAYGLATLLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPDLQFGDAEEKSLARWYTRAARIYALMVLIFLGLGEWISVEVLADGVSSTTDLKRTAGSLAAGFTALIVSALVGTKQTGE*
Ga0126305_10000051363300010036Serpentine SoilVIPENLERARRLFWLGRSLLALSAILLPVIAYGLAALLVDGTAEKEYYEAIAQILPVLLLALAIEQRYFTQGQSMPALPSELQFGEAEVKSLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFTALIVTALVGTKQTGD*
Ga0126304_1004770823300010037Serpentine SoilVIPENLERARRLFWLGRSLLALSAILLPVIAYGLAALLVDGTAEKEYYEAIAQILPVLLLALAIEQRYFTQGQSMPDLPSELQFGEAEVKSLARWYTRTARIYSLMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAPGFTALIVTALVGTRSVDNA*
Ga0157294_1005508723300012892SoilMSSQVRVGRVWKFAFGVGAIIAPLVAYALAALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFDRAGRERAPESQLQLELAGRRLDDQAMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQSAE*
Ga0157284_10000119103300012893SoilVIPENLERARRLFWLGKSLLALSAILLPLLAYGLAALLVDGLAQKEYYEAISQILPVLLLALAIEQRYFTQGQSMPDLPPELQFGEGEVKRLARWYTIAARVYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFTALIVSALVGTKRTGD*
Ga0157299_1015866113300012899SoilRPRTDRLFVRRGWNAAGVIPENLERARRLFWLGRSLLALSAILLPVLAYGLAALLIDGTAEKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAEVKSLARWYTRAARIYALMVLLALGFGEWIAVEVLAEGSSSTADLKNTAGSLAAGFTALIVSALVGTKQSSE*
Ga0157288_1005880513300012901SoilVSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLRLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSAVVGTKQTSE*
Ga0157291_1016113523300012902SoilLFWLGRFLLAVGAILLPVLAYGLTALLVDGRANEQYFEAVSQILPVLLLALAIEQRYFTRLQAMPDLPPQLEFGEAETRDLARWYTRAARIYALMVLVFLGFGEWIAVEVLATGESSGADLENTAGSLAAGFTALIVSALVGTKQSTN*
Ga0157296_1018514213300012905SoilISESVARSRRFFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAETRQLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTTADLKNTAGSLAAGFTALIVTALIGTKQASD*
Ga0157286_1001249933300012908SoilVIPENLERARRLFWLGKTLLALSAILLPVVAYGLAALLVDGTAEKEYYEAISQILPVLLLALAIEQRYFTQGQSMPEFPPELDFDPAETRNLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFTALIVTVLVGTKQTAD*
Ga0157290_1000198923300012909SoilMSGQVRAGLVWKFAFGVGAIVAPVVAYAVTALLVEGHAEKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRSLARWYTLAARIYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSVLVGTKQSSK*
Ga0157302_1017614623300012915SoilMSGQVRAGLVWKFAFGVGAIVAPLVAYALAALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFSRAGRERAPESPLQLELAGRRLDDRAMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTRGEHR*
Ga0162650_10000038533300012939SoilMSGQVRVGLVWRFAFGVGAIVAPVAAYALAALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGSERAPESPVQLELAGRRLDDRAMARWYTLAARVYALVVLILLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQRSE*
Ga0164298_1020245133300012955SoilMSSQVRVGLVWKFAFGVGAIVAPLLAYALTALLVDGHAQVKYFEAVAQILPVLLLALAIEQRYFTRAGRERAPESPLQLELGGRRLDDRAMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKTERG*
Ga0164298_1025905333300012955SoilVISESLARSRRLFWLGRFLLALSAILLPIVAYGLTVLLVDGHAEKEYFEAVSQILPVLLLALAIEQRYFTRAQSMPDLPSELQFGDAEMRSLARWYTRAARLYALMVLIFLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQRSECSVASFPPYRG*
Ga0164299_1097136223300012958SoilMSSEVRVGLVWRFAFGVGAIAAPLLAYALTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDGTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKTTAGSLAAGFTALNVTALVGTKRTGECRLVN*
Ga0164301_10000015203300012960SoilVIPENLERARRLFWLGRSLLALSAILLPLLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQAMPELPAELEFGEAEVRRLARWYTRAGRLYALLVLLALGFGEWVAIEVLATGSSSTADLKNTAGSLAAGFTALIVTALVGTKRTGE*
Ga0164301_10000131193300012960SoilMSSQVRVGLVWKFAFGVGAIVAPLLAYALTALLVDGHAQVKYFEAVAQILPVLLLALAIEQRYFTRAGRERAPETPLQLELAGRRLDDRAMARWYTLAARAYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKSERT*
Ga0164302_10000031233300012961SoilMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSAVVGTKQSAE*
Ga0157369_10000130373300013105Corn RhizosphereMAPESIARARRLFWLGKVLLAVGAVAAPVAAYVLATVLVSGTAEEEYFEAVSQILPVLLLALAVEQRYFTRDQSMPELPAELQFGEAEFKKLNRLYALSARAYALIVLLALGIGEAIAVQVLATGDSGGDDLQKTAGSLAAGFTALIVSALVGTKQARD*
Ga0157378_1006867933300013297Miscanthus RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSAVVGRNRPPTDDW*
Ga0157372_10000770223300013307Corn RhizosphereMSSQVRVGLFWRFAFGAGAIAAPVVAYVVTALVVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRARAPESPLQLELAGKQLVDEQRMARWYTLAARIYALVVLALLGMGEWIAVEVLATGHSSTADLKNTAGSLAAGFVALIVSALVGTKAERTD*
Ga0157380_10000273133300014326Switchgrass RhizosphereMSGQVRVGLVWRFAFGVGAIVAPIVAYALAALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFTRAGSERAPESPVQLELAGRRLDDRSMARWYTLAARVYALVVLILLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQAAE*
Ga0157380_1099634513300014326Switchgrass RhizosphereMSTQVRAGLIWKFAFGVAAIAAPVVAYAVTALLVDGHAKPEYFDAVSQILPVLLLALAIEQRYFARAGRERAPESPLQVEVAGRRLDDRAMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTGD
Ga0182000_1002471723300014487SoilVIPENLERARRLFWLGRTLLALSAILLPVVAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPALPPELQFGEGEVKRLARWYTVAARIYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFIALIVTALGGTGRTAD*
Ga0157376_1038357413300014969Miscanthus RhizosphereAFGVGAIAAPILAYAVVALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTSE*
Ga0173478_1026970223300015201SoilVRLEADCLDRRLSVAAASAGAGTLPGVISESVARSRRFFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAETRQLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTTADLKNTAGSLAAGFTALIVTALIGTKQASD*
Ga0132256_10183813313300015372Arabidopsis RhizosphereMSSEVRVGLVWRFAFGVAAIAAPVVAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFARAGRERAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGESSGADLKNTAGSLAA
Ga0132255_10095824623300015374Arabidopsis RhizosphereAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFARAGRERAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKRTAD*
Ga0190266_1006846723300017965SoilMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFARAGRERAPESPVQLELAGRRLDNRTMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRTAD
Ga0184624_1000005943300018073Groundwater SedimentVIPENLERARQLFWLGRSLLALSAILLPVVAYGLAALLVEGIAQKEYYEAISQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAEVKSLARWYTRAARIYALMVLLALGLGEWIAVEVLAEGSSSTADLKNTAGSLAAGFTALIVTALVGTKQAAD
Ga0190269_10000047493300018465SoilMSSEVRVGLVWRFVFGVGAIAAPVIAYAVTALMVDGHARKEYFEAVSQILPVLLLALAIEQRYFTRAGSEPAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKRTAS
Ga0190269_1010534123300018465SoilMSTEVRAGLVWKFAFGVAAIAAPVIAYAVAALLVDGHAEKEYFEAVSQILPVLLLALAIEQRYFTRQPPPAPESPLQLELAGRRLDDRSMARWYTLAARIYALVVLFSLGWGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0190269_1034509923300018465SoilMSKQARLALLGKFTFAVAAIVAPVLAYVVTALLVAGHAEKEYFEAVSQIIPVLLLALAIEQRYFTRRQAAPESPIQLELAGRRLDDRSMAKWYTLAARIYALVVLIVLGLGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0190274_1313343923300018476SoilMSSRVRVGLFWRFAFGVGAIAAPVVAYVVIALAVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGRGRAPESPLQLELAGKQLVDEQRMARWYTLAARIYALVVLALLGMGEWIAVEVLATGHSSTWDLKN
Ga0190271_1022048923300018481SoilMSSQVRVGLVWKFAFGIGAIIAPLVAYALAALLVDGRAQESYFDAVSQILPVLLLALAIEQRYFTRAGREQAPESPLQLELAGRRLDDQAMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGAKQTAE
Ga0190273_10000611133300018920SoilVSSELRLALFWRFAFGVGAIAAPVVAYVVVALIVDGHATKEYFEAVSQILPVLLLALAVEQRYFTRAGRERAPETPLQLELAGRSLVDEQKMARWYTLAARVYALVVLIVLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKPQRAD
Ga0190273_1013281333300018920SoilVSSELRLALFWRFAFGVGAIAAPVVAFAIAALAVDGTARHEYFDAVSQILPVLLLALAIEQRYFTRAGSEAAPETPLQLELGGRRLDDRTMARWYTLAARIYALVVLVVLGLGEWVAVEVLATGQSSSGDLSITAGSLTAGFTALIISALVGTKKERS
Ga0190273_1077035223300018920SoilMSSRVRVSLFWRFALGVAAIAAPVFAYSVTALLVDGNAQKEYFEAVSQILPVLLLALAIEQRYFARAGSEPAPQTPVQLELAGRQVLDDREIARWYTLAARIYALMVLVVLGFGEWIAVEVLATGQSTTADLKNTAGSLAAGFTALIVSALVGTKQSRD
Ga0190273_1091140423300018920SoilMSSRVRVSLFWRFALGVAAIAAPVFAYSVIALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFARAGSEPVPQTPVQLELAGRQVLDDREIARWYTRAARIYALMVLVVLGFGEWIAVEVLATGQSTTADLKNTAGSLAAGFTALIVSALVGTKQSRD
Ga0190273_1093451613300018920SoilMPRELRLALLWRFVLAIAAIASPVLAYGLTGLLVDGHAKKEYFEAVSQILPVLLLALAVEQRYFTRREPAPESPLRLEVRGYRLDDAELARWYTLAARIYALMVLVVLGLGEWIAVEVLATGHSSTADLKNTAGS
Ga0190273_1219351723300018920SoilMSPQARATLAWKFVFAIAAIAAPVVAYGVTALLVEGHAEQEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLQLELAGRRLDDRSMARWYTLAARIYALVVLFALGFGEWIAVEVLATGESSGADLEN
Ga0193697_106789823300020005SoilAPVIAYAVTALVVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRGRAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0196958_1006003313300020181SoilVIPESLARARRLYWLGRFLVAASPIALPVIAYLLAILLVDGRAKEEYFEAVSQILPVLLLALAIEQRYFTRGQSIPDLPPELEFGQAEIRQLNRLYTAAARIYALIVLIALGAGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTSE
Ga0196958_1006942533300020181SoilMSPQARAALAWKFVFAIAAIAAPVVAYVVTALLVEGRAKEEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLQLELAGRRLDDRSMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGESTGADLKNTAGSLAAGFTALIVSALVGTKQIAK
Ga0193699_1011387723300021363SoilAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKQERG
Ga0247792_101958023300022880SoilVSLFWRFAFGVGAIAAPVIAYVVVALIADGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPEAPLQLELAGRQLVDDRRMARWYTLAARIYALVVLIVLGLGEWIAVEVLATGHSSTSDLKNTAGSLAAGFTALIVSALVGTKAERSD
Ga0247786_100747723300022883SoilVIPENLERARRLFWLGRFLLAVSAILLPVVVYGLTALLVDGHAQKEYFEAVSQILPVLLLALSIEQRYFTRGQSMPEFPPELDFNEAETRDLARWYARAGRVYALMVLLALGLGEWIAVEVLATGSSTTSDLKNTAGSLAAGFTALIGTKQTAD
Ga0247795_100012943300022899SoilMSSEVRVGLVWRFAFGVGAIVAPLVAYAVTALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRSMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGAKQTTD
Ga0247768_105969323300022910Plant LitterMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYAIVVLFLLGFGEWIAVEVLATGTSSTADLKNTAGSLAAGFTALIVSALVGTKQTAE
Ga0247791_100340233300023062SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGEAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0247755_1000007353300023070Plant LitterMSSQVRVGRVWKFAFGIGAIVAPLVAYALAALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFDRAGRERAPESPLQLELAGRRLDDQAMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGESSTADLKNTAGSLAAGFTALIVSALVGTKSERA
Ga0247752_101572333300023071SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQTAE
Ga0247802_100082533300023077SoilVIPENLKRARRLFWLGKAAVLTTAVAAPVFAFLLTAALVDGIAHEQYFEAVSQILPVLLLALAVEQRYFAGSRSMPELPPELNFGEAQIRKLSRLYGLTATVYALVVLVALALGEWIAVEVLATGHSSSGDLKSTAGSLAAGFTALIVSALVGTKQAADRQVES
Ga0247802_100577633300023077SoilVIPENLERARRLFWLGKSLLLLGAVVVPALSFGIAIALVDGHAQKEYFEAVSQILPVLLLALAVEQRYFTREQSLPDLPPELEFGETEDRRLARLYNVTARLYALLVLFALGLGEWVAVEVLATGQSSTSDLKLTAGSLTAGFTALIVTALIGTKQTAD
Ga0247789_106200423300023266SoilMSSEVRVNLFWRFALGVAAIAAPVIAYAVTALLVDGHAKEEYFEAVSQILPVLLLALAIEQRYFTRAGREQAPESPLRLELAGRRLDDRAMARWYTLAARIYALVVLIALGFGEWIAVEVLATGESSGADL
Ga0247776_10000237133300023275Plant LitterMSSQVRVGLVWRFAFGVGAIVAPLLAYALTALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPETPLQLELAGRRLDDRAMARWYALAARVYALVVLFLLGFGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKTERT
Ga0247672_102739723300024187SoilVSSELRLARFWRFAFGVGAIAAPVLAYVVVALIVDGQATKEYFEAVSQILPVLLLALAVEQRYFTRAGRERAPETPLQLELAGRSLVDEQKMARWYTLAARLYALVVLVVLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQDR
Ga0196960_10000035123300024426SoilMATGAGRPDLSKQARAVLVGKFAFGVGAIAAPVLAYVVTALLVEGHAEKEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLQLELAGRRLDDRAMARWYTLAARIYALVVLVVLGLGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTSE
Ga0196960_1000946433300024426SoilMSKQARLALLGKFTFAVAAIVAPVLAYVVTALLVDGHAEKEYFEAVSQIIPVLLLALAIEQRYFTRRQAAPESPIQLELAGRRLDDRSMARWYTLAARIYALVVLIVLGLGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTD
Ga0207656_10000114313300025321Corn RhizosphereVIPENLRQARRLFWLGKTLLALSAILLPVVAYGLAPLLVEGHAQKEYFEAVSQILPVLLLALAIEQRYFTRRQSMPEFPPELDFNEAETRDLARWYTRAARIYALMVLVALGLGEWTAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKAERTD
Ga0207656_1000755413300025321Corn RhizosphereLDRRLSRPVSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLGLAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAD
Ga0207710_1034194923300025900Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAYAVTALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAE
Ga0207705_1004070833300025909Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSAE
Ga0207662_1022664823300025918Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVLAYAVAALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSAADLKNTAGSLAAGFTALIVSAVVGTKQSAE
Ga0207649_100000051793300025920Corn RhizosphereVISESVARSRRLFWLGRSLLALSAILLPVVAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPELPAELQFGEAEERSLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTSADLKNTAGSLAAGFTALIVTALIGTKRTGD
Ga0207659_10000014483300025926Miscanthus RhizosphereMSSEVQVGLVWRFAFGVGAIAAPVVAYAVTALLVGGHARKEYFEAVSQILPVLLLALAIEQRYFDRAGSEPAPESPLQLELGGRRLDDRTMARWYTFAARAYALVVLFLLGFGEWIAVEVLATGSSTTSDLKNTAGSLAAGFTALIVSALVGTKRTASR
Ga0207687_10000011523300025927Miscanthus RhizosphereVIPENLERARRLFWLGKAAVLLGAVVVPFFVFVATMALVDGHAAKEYFEAVSQILPVLLLALAVEQRYFTSSQSMPELPPGLDFNEADSKRVTRLYAFTARLYALSVLFALGLGEWIAVEVLATGESSTTDLKATAGSLAAGFTALIVSALVGTKRER
Ga0207687_10003353113300025927Miscanthus RhizosphereVIPENLRQARRLFWLGRTLLALSAILLPVVAYGLATLLVEGHAQKEYFEAVSQILPVLLLALAIEQRYFTRRQSMPEFPPELDFNEAETRDLARWYTRAARIYALMVLVALGLGEWTAVEVLATGHSSTADLKNTAGSLAAGFVALIVSALVGTKAEPAE
Ga0207709_1001758933300025935Miscanthus RhizosphereMALSAILLPIVAYLLAALLVDGTAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPEFPPDLDFNPAETRSLARWYTRAARVYALMVLLALGLGEWIAVEVLADGSSSTADLKNTAGSLAAGFTALIVTALVGTRSVDNA
Ga0207691_10000284263300025940Miscanthus RhizosphereVITESVVRSRQLFWLGRSLLALSAILLPVLAYGLAALLVDGHAEKEYFEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEAEMRKLARWYTRAARTYALLVLIALGLGEWIAVEVLATGQSSTADLKNTAGSLAAGFTALIVSALVGTKQTGG
Ga0207711_100000242293300025941Switchgrass RhizosphereMIPENLQRARRLFWLGKAGVLVGAAAVPAFAFLIAMALVDGHAREEYFEAVSQILPVLLLALAIEQRYFTSSQAMPELPAELEFGNDEIERIARLYAFTARVYALVVLFALGLGEWIAVEVLAAGSSSSTDLKITAGSLAAGFSALIVTALVGTKRER
Ga0207661_1020649723300025944Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAFLIAALLVEGEARNEYFDAVSQILPVLLLALAIEQRYFTRAGREPAPESPLQLELAGRRLDDRTMARWYTLAARIYALVVLIVLGLGEWVAVEVLATGESSSGDLSITAGSLAAGFTALIVSALVGTKQTSA
Ga0207668_1074055223300025972Switchgrass RhizosphereVIPENLERARRLFWLGRTLLALSAILLPVVAYGLAALLVDGIAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPELPPELQFGEAEVKGLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSTTADLKNTAGSLAAGFTALIVTALVGTKQAAD
Ga0207668_1106400513300025972Switchgrass RhizosphereRLFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPELPAELQFGEAETRQLARWYTRAGRVYALLVLLALGFGEWIAVEVLATGSSSTADLEKTAGSLAAGFTALIVSALVGTKQTAE
Ga0207640_10000128313300025981Corn RhizosphereMSSQVRVGLFWRFAFGVAAIAAPVVAYVVIALVVDGHAQKEYFEAISQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGKQLVDEQRMARWYTLAARIYALVVLALLGMGEWISVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKAGRAE
Ga0207677_1000049733300026023Miscanthus RhizosphereVISENVARSRRFFWLGRSLLALSAILLPVLAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEDETRQLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGSSTTADLKNTAGSLAAGFTALIVTALLGTRQTNQPV
Ga0207683_1004395643300026121Miscanthus RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVVAYAVTALLVDGHAKQEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLRLELAGRRFDNRTMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQSAE
Ga0207698_1003553943300026142Corn RhizosphereMSSEVRVGLVWRFAFGVGAIAAPVIAFAVAALLVDGTAKDGYFDAVSQILPVLLLALAIEQRYFTRAGSEAAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLVVLGLGEWVAVEVLATGESSSGDRSITAGSLAAGFTALIVSALVGTKQPGN
Ga0209152_10000384113300026325SoilVIDENLERARRLFWLGKTLLALSAILLPIVAYLFAALLVDGTAEKEYYEAVSQILPVLLLALAIEQRYFTQGQSMPEFPPDLDFNPAETRRLARWYTRAARIYALMVLLALGLGEWIAVEVLADGSSTTADLKNTAGSLAAGFTALIVTALVGTKQTAE
Ga0209267_102669933300026331SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYVVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGQERAPESPLQLELAGRRLDDATMARWYTLAARVYALVVLVLLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKRSSR
Ga0268266_10000303563300028379Switchgrass RhizosphereMSSEVRVGLVWRFAFGVGAIAAPLLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDNRTMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSAVVGTKQTSE
Ga0268265_1055022033300028380Switchgrass RhizosphereVITETVAESVVRSRRLFWLGRSLLALSAILLPVVAYVLAALLVDGHARKEYFEAVSQILPVLLLALAIEQRYFARGHSMPDLPPELQFGEAEMRSLARWYTRAGRIYALLVLIALGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIITALVGTKASQAE
Ga0307285_10000011543300028712SoilMSSEVRVALVWRFAFGVGAIAAPLVAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGSEPAPESPLQLELGGRRLDDRTMARWYTLAARAYALVVLFLLGFGEWIAVEVLATGQSSSADLKNTAGSLAAGFTALIVSALVGTKNSGR
Ga0307319_100000042073300028722SoilMSSEVRVGLVWRFAFGVGAIAAPVIAFAVAALVVDGTAQKEYFDAVSQILPVLLLALAIEQRYFTRAGSEPAPESPLQLELAGRRLDDRTMARWYTLAARIYALVVLIVLGLGEWVAVEVLATGQSSPGDLSVTAGSLAAGFTALIVSALVGTRRPTD
Ga0307297_1000210453300028754SoilVSSELRLALFWRFAFGVGAIVAPVLAYVVVALIVEGHATKEYFEAVSQILPVLLLALAVEQRYFTRAGRERAPETPLQLELAGRSLVDEQKMARWYTLAARLYALVVLVVLGLGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTRQAGD
Ga0307280_10000016763300028768SoilMSSEVRVGLVWRFAFGVGAIAAPVLAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFARAGRERAPESPVQLELAGRRLDNRTMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSLAAGFTALIVSALVGTKQSAE
Ga0307288_100000013533300028778SoilVIPENVARARRLFWLGKTLLALGAILLPIIAYALVALVVQGHAKDEYFEAVSQILPVLLLALAIEQRYFTRRQSMPDLPPELEFSEADVRDLSRWYSRAAKVYALMVLAILGLGEWIAVEVLATGQSSEADLQNTAGSLAAGFTALIVSALVGTKRQVD
Ga0307306_1000003543300028782SoilVIPENLKQARRLFWLGRTLLALSAILLPILAYGLATLLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRSQSMPEFPPELDFNPGETQDLARWYTRAARIYALMVLVFLGFGEWIAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKQQNS
Ga0307503_100000051343300028802SoilMSSEVRVGLVWRFAFGVAAIAAPVIAFAVAALLVDGRAEKEYFEAISQILPVLLLALAIEQRYFTRAGRDPAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLVVLGLGEWVAVEVLATGQSSSGDLSITAGSLAAGFTALIVSALVGTKQTTN
Ga0307314_1003933023300028872SoilVSSEVRVGLVWRFAFGVGAIAAPLIAYAVTALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRTMARWYTLAACVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTAGSSPPASPP
Ga0307501_1000963723300031152SoilMSGQVRVGLVWRFAFGIGAIVAPVLAYALAALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFTRAGSERAPESPVQLELGGRRLDDRAMARWYTLAARVYALVVLILLGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQRSE
Ga0308175_100000066903300031938SoilVISESVARSRRLFWLGRSLLALSAILLPVVAYGLAALLVDGHAQKEYYEAVSQILPVLLLALAIEQRYFTRGQSMPELPPELHFGEAEERSLARWYTRAARLYALLVLLALGLGEWIAVEVLAEGLSTTADLKNTAGSLAAGFTALIVTALIGTKRTGD
Ga0326721_10000004643300032080SoilMSTEVRVSLVWRFALGVAAIAAPVVAYAIAALLVEGQAEKEYFEAVSQILPVLLLALAIEQRYFDRAGRERAPESPLQLELAGRRLDDRTMARWYTLAARIYALVVLIALGFGEWIAVEVLATGESTGADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0307415_10000692263300032126RhizosphereMSSEVRVSLVWRFALGVAAIAVPVVAYGITALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRRPSPAPESPLQLQLAGRRLDDRAMARWYTLAARIYALVVLAVLGLGEWIAVEVLATGESSAADLKNTAGSLAAGFTALIVSALVGAKGSTAGEG
Ga0307472_10001785643300032205Hardwood Forest SoilVSSELRLALFWRFAFGAGAIAAPVVAYVVVALVADGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGHSLLDEQKMARWYTRAARAYALVVLIVLGLGEWLAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKQAD
Ga0334918_001360_1618_20973300034000Hypolithic BiocrustVIPENLERARRLFWLGKSLLALSAILLPLLAYGLAALLVDGHAQKEYYEAISQILPVLLLALAIEQRYFTRGQSMPDLPPELQFGEGEVKRLARWYTVAARVYALMVLLALGLGEWVAVEVLAAGQSSTSDLKLTAGSLAAGFTALIVTALIGTKQTAD
Ga0334918_013964_460_9303300034000Hypolithic BiocrustMSSEVRVGLVWRFAFGVGAIAAPVLAYVITALLVDGHAQKEYFEAVSQILPVLLLALAIEQRYFTRAGQERAPESPLQLELAGRRLDDATMARWYTLAARVYALVVLFLLGFGEWIAVEVLATGSSSTADLKNTTGTLAAGFTALIVSALVGTKRN
Ga0334930_002195_1957_24333300034005Sub-Biocrust SoilVSSELRLALFWRFAFGVGAIAAPVIAYVITALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGHSTTADLKNTAGSLAAGFTALIVSALVGTKQQSD
Ga0334911_002446_422_8953300034131Sub-Biocrust SoilMSPQARAALVWKFVFAIAAIAAPVVAYGLTALLVDGHAEEEYFEAVSQILPVLLLALAIEQRYFTRRPPPAPESPLQLELAGRRLDDRSMARWYTLAARIYALVVLFALGFGEWIAVEVLATGESSGADLKNTAGSLAAGFTALIVSALVGTKQTSE
Ga0334915_000002_87395_878713300034132Hypolithic BiocrustMSSQVRVGLIWRFAFGVAAIAAPPLAYLVTALLVDGHAQEQYFEAVSQILPVLLLALAIEQRYFTRAGRDPAPETPVQLELAGRRLDDRAMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGESTTADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0334933_041496_1_4563300034136Sub-Biocrust SoilALVWKFVFAIAAIAAPVVAYGLTALLVDGHAEEEYFEAVSQILPVLLLALAIEQRYFTRAGRDPAPETPVQLELAGRRLDDRAMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGESTTADLKNTAGSLAAGFTALIVSALVGTKQTAD
Ga0334925_001168_893_13693300034173Hypolithic BiocrustVSSELRLALFWKFAFGVGAIAAPVIAYVITALLVDGHAKKEYFEAVSQILPVLLLALAIEQRYFTRAGRERAPESPLQLELAGRRLDDRTMARWYTLAARVYALVVLVVLGLGEWIAVEVLATGHSSTADLKNTAGSLAAGFTALIVSALVGTKQQSD
Ga0334905_000064_3904_43833300034687SoilVSSELRLALFWRFAFAVGAIAAPVVAYVVVALIVDGQATQEYFEAVSQILPVLLLALAVEQRYFTRAGRERAPETPLQLELAGHRLVDEQKMARWYALAARVYALVVLVVLGLGEWIAVEVLATGQSSSADLKNTAGSLAAGFTALIVSALAGTKQTAD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.