Basic Information | |
---|---|
Taxon OID | 3300018515 Open in IMG/M |
Scaffold ID | Ga0192960_100022 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6107 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: TARA_083 | |||||||
Coordinates | Lat. (o) | -54.3739 | Long. (o) | -65.1342 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001488 | Metagenome / Metatranscriptome | 686 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0192960_1000228 | F001488 | AGG | LSLQEHLNHMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK |
⦗Top⦘ |