Basic Information | |
---|---|
Taxon OID | 3300017923 Open in IMG/M |
Scaffold ID | Ga0182239_1030168 Open in IMG/M |
Source Dataset Name | Subsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 6_PW_210 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 900 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Fastidiosipila → unclassified Fastidiosipila → Fastidiosipila sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Texas | |||||||
Coordinates | Lat. (o) | 30.238 | Long. (o) | -102.628 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086646 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182239_10301681 | F086646 | N/A | TMDFIFRIQNHYFEKGTPWVELDKIKQRSWFLSVDIEDDEVLPCYDTVHELRISQGIAFKSVKILTGKTQETHPYWEALLDMSYSNSTELRDVIFKDLPGESGNYMLNIWFDYDGEDINFGDTFKKLCEYRHKWDDGWVCSRCGVRKADWVEADIKGGE |
⦗Top⦘ |