| Basic Information | |
|---|---|
| Taxon OID | 3300017034 Open in IMG/M |
| Scaffold ID | Ga0186514_100001 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 557 ?mol photons light - Craspedostauros australis CCMP 3328 (MMETSP1442) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11220 |
| Total Scaffold Genes | 25 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -38.45 | Long. (o) | 145.3333 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021307 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186514_1000016 | F021307 | N/A | MSQIFYEKRCRCKEEFLITKKRKSSNRSEGKPLQYPSSNEILSKTFKIKYENELSSRAKLILNSLKNKYLYYAXXXIDKFL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |