NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017034

3300017034: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 557 ?mol photons light - Craspedostauros australis CCMP 3328 (MMETSP1442)



Overview

Basic Information
IMG/M Taxon OID3300017034 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212226 | Ga0186514
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 557 ?mol photons light - Craspedostauros australis CCMP 3328 (MMETSP1442)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18870909
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)-38.45Long. (o)145.3333Alt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021307Metagenome / Metatranscriptome219Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186514_100001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11220Open in IMG/M
Ga0186514_100199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3183Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186514_100001Ga0186514_1000016F021307MSQIFYEKRCRCKEEFLITKKRKSSNRSEGKPLQYPSSNEILSKTFKIKYENELSSRAKLILNSLKNKYLYYAXXXIDKFL
Ga0186514_100199Ga0186514_1001991F021307MSQIFYEKRCRCKEEFLITKKRKSSNRSEGKPLQYPSSNEILSKTFKIKYENELSSRAKLILNSLKNKYLYYAIDDILFLFKLKPIEGENLLNILYSTVLSIHNNLSIN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.