| Basic Information | |
|---|---|
| Taxon OID | 3300017024 Open in IMG/M |
| Scaffold ID | Ga0186263_101339 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o silicate, 20 C and 216 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0706) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1655 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 32.655 | Long. (o) | -117.14 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021307 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186263_1013394 | F021307 | N/A | MNRILYDSRCRCKEEFSITKKRKPSGRSEGKPLQYPNEIMSKTFQIKYEKKLSLVARFILTSFRNKYLYYAIDDILYLLKANPIERENLLSILYSPVLSLQNNFCINFFDIWIYE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |