NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017024

3300017024: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o silicate, 20 C and 216 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0706)



Overview

Basic Information
IMG/M Taxon OID3300017024 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211975 | Ga0186263
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o silicate, 20 C and 216 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0706)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size16775613
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)32.655Long. (o)-117.14Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015298Metagenome / Metatranscriptome255Y
F021307Metagenome / Metatranscriptome219Y
F078213Metagenome / Metatranscriptome116Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186263_101339All Organisms → cellular organisms → Eukaryota → Sar1655Open in IMG/M
Ga0186263_112026All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta552Open in IMG/M
Ga0186263_112801All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta510Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186263_101339Ga0186263_1013394F021307MNRILYDSRCRCKEEFSITKKRKPSGRSEGKPLQYPNEIMSKTFQIKYEKKLSLVARFILTSFRNKYLYYAIDDILYLLKANPIERENLLSILYSPVLSLQNNFCINFFDIWIYE
Ga0186263_112026Ga0186263_1120261F078213SLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI
Ga0186263_112801Ga0186263_1128011F015298MNAILEYLIAHKDWLLLVCFSVDAVNTLISFPLIMWKGPKWLLQSTDPDAKEKVEDAKVVVDLTDTDRKSFEVLWEIFGICYEGYFGFTISTLICLFKVPETRPIFAYSLFALYLYKAKAFLRTTIKTDNPQGKGKFMSILFFYWPCYGGYCLLHSIE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.