| Basic Information | |
|---|---|
| Taxon OID | 3300017010 Open in IMG/M |
| Scaffold ID | Ga0186589_111109 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 107 ?mol photons light - Chaetoceros cf. neogracile RCC 1993 (MMETSP1336) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 789 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 70.68333333 | Long. (o) | -138.3666667 | Alt. (m) | Depth (m) | 65 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078213 | Metagenome / Metatranscriptome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186589_1111091 | F078213 | N/A | MGDTLKLEKGFKTMWNPPAVENMMGRNDENSLKGLGEAFKGAVDNIGFKQLAPQEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCMIEDILKVL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |