x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300017010
3300017010: Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 107 ?mol photons light - Chaetoceros cf. neogracile RCC 1993 (MMETSP1336)
Overview
Basic Information
IMG/M Taxon OID 3300017010 Open in IMG/M GOLD Reference Gs0128947 | Gp0212301 | Ga0186589 Sample Name Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 107 ?mol photons light - Chaetoceros cf. neogracile RCC 1993 (MMETSP1336) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 22744446 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Sar 1 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location Arctic Ocean Coordinates Lat. (o ) 70.68333333 Long. (o ) -138.3666667 Alt. (m) N/A Depth (m) 65 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F067805 Metagenome / Metatranscriptome 125 Y F078213 Metagenome / Metatranscriptome 116 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186589_108783 All Organisms → cellular organisms → Eukaryota → Sar 1031 Open in IMG/M Ga0186589_111109 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae 789 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186589_108783 Ga0186589_1087832 F067805 MAGSKNKAPKEEEIILSKKDQKKVDKLTAMIPYHEGRQHAEEVGKIKEKVDAIWQKAKEAHMYALTHXLIQI Ga0186589_111109 Ga0186589_1111091 F078213 MGDTLKLEKGFKTMWNPPAVENMMGRNDENSLKGLGEAFKGAVDNIGFKQLAPQEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCMIEDILKVL
