| Basic Information | |
|---|---|
| Taxon OID | 3300016850 Open in IMG/M |
| Scaffold ID | Ga0186201_101932 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium w/o silicate, at 20 C, 30 psu salinity and 743 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0745) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2251 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | 0 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012917 | Metagenome / Metatranscriptome | 276 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186201_1019321 | F012917 | N/A | LFKFLRFPLNDCGYYDKYSSLSEVNQVWDRKKHLKRKRWSQE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |