NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119972_1004056

Scaffold Ga0119972_1004056


Overview

Basic Information
Taxon OID3300013759 Open in IMG/M
Scaffold IDGa0119972_1004056 Open in IMG/M
Source Dataset NameIntertidal thrombolitic mat microbial community from Highborne Cay, Bahamas - Thr-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Florida
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2742
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Intertidal Thrombolitic Mat → Intertidal Thrombolitic Mat Microbial Community From Highborne Cay, Bahamas

Source Dataset Sampling Location
Location NameBahamas: Highborne Cay
CoordinatesLat. (o)24.43Long. (o)-76.49Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y

Sequences

Protein IDFamilyRBSSequence
Ga0119972_10040563F001506N/AMNRILYFFSSRCKEKEEFSITKKRKSTNRSEGKPLKYPSPNDIKVKTFQIKYEKKLSSIAKLTLNSFRNKYLYYAIDDILYLFKSNPIERDNLLAVLYSPVLSLHNNFSINFFDIWIHEIYINEISKVNKFLTTDFQNLEQCSYITIKFLYQTRLPGKKQESLW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.