Basic Information | |
---|---|
Taxon OID | 3300013759 Open in IMG/M |
Scaffold ID | Ga0119972_1004056 Open in IMG/M |
Source Dataset Name | Intertidal thrombolitic mat microbial community from Highborne Cay, Bahamas - Thr-A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Florida |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2742 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Intertidal Thrombolitic Mat → Intertidal Thrombolitic Mat Microbial Community From Highborne Cay, Bahamas |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bahamas: Highborne Cay | |||||||
Coordinates | Lat. (o) | 24.43 | Long. (o) | -76.49 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001506 | Metagenome / Metatranscriptome | 681 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119972_10040563 | F001506 | N/A | MNRILYFFSSRCKEKEEFSITKKRKSTNRSEGKPLKYPSPNDIKVKTFQIKYEKKLSSIAKLTLNSFRNKYLYYAIDDILYLFKSNPIERDNLLAVLYSPVLSLHNNFSINFFDIWIHEIYINEISKVNKFLTTDFQNLEQCSYITIKFLYQTRLPGKKQESLW* |
⦗Top⦘ |