| Basic Information | |
|---|---|
| Taxon OID | 3300011934 Open in IMG/M |
| Scaffold ID | Ga0152300_143475 Open in IMG/M |
| Source Dataset Name | Stromatolite microbial communities from hypersaline Socompa Lake, Salta, Argentina - SSH_201008 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Molecular Genetics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1158 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Stromatolites In Hypersaline Lake → Stromatolite Microbial Communities From Hypersaline Socompa Lake, Salta, Argentina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Salta, Argentina | |||||||
| Coordinates | Lat. (o) | -24.534588 | Long. (o) | -68.208687 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001057 | Metagenome / Metatranscriptome | 791 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0152300_1434752 | F001057 | N/A | MTNACHDNGMKSTLELDTSNRIVITRELRKAAGIPRRQKLIVSATPGRIVLEVEPNTMGQVVKRGLLRVWTGDVPETSIQDAVDQARHYSR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |