Sample 3300011934

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300011934

3300011934: Stromatolite microbial communities from hypersaline Socompa Lake, Salta, Argentina - SSH_201008

Overview

Basic Information
IMG/M Taxon OID	3300011934 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0126206 \| Gp0175553 \| Ga0152300
Sample Name	Stromatolite microbial communities from hypersaline Socompa Lake, Salta, Argentina - SSH_201008
Sequencing Status	Permanent Draft
Sequencing Center	Max Planck Institute for Molecular Genetics
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	148027649
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Stromatolite Microbial Communities From Hypersaline Socompa Lake, Salta, Argentina
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Stromatolites In Hypersaline Lake → Stromatolite Microbial Communities From Hypersaline Socompa Lake, Salta, Argentina

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hypersaline lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	Salta, Argentina
Coordinates	Lat. (^o)	-24.534588	Long. (^o)	-68.208687	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001057	Metagenome / Metatranscriptome	791	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0152300_143475	All Organisms → cellular organisms → Bacteria	1158	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0152300_143475	Ga0152300_1434752	F001057	MTNACHDNGMKSTLELDTSNRIVITRELRKAAGIPRRQKLIVSATPGRIVLEVEPNTMGQVVKRGLLRVWTGDVPETSIQDAVDQARHYSR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.