NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137008_104851

Scaffold Ga0137008_104851


Overview

Basic Information
Taxon OID3300011237 Open in IMG/M
Scaffold IDGa0137008_104851 Open in IMG/M
Source Dataset NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 2 - S13.2.20.a - transect 2, age 3 years, surface depth)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1014
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameNorway: Midre Lovenbreen, Svalbard
CoordinatesLat. (o)79.112223Long. (o)12.175Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008258Metagenome / Metatranscriptome336Y

Sequences

Protein IDFamilyRBSSequence
Ga0137008_1048513F008258GAGGVTQDPIEQALDKLGSLGVPVNDISEKAGAIVGQFGSFDLFEMLDQAMSIDPSQLDVGEMFAELKSKYDDLDPALKVPVAIAAGFVGARVVRWIVR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.