| Basic Information | |
|---|---|
| Taxon OID | 3300011196 Open in IMG/M |
| Scaffold ID | Ga0137482_100058 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 17 - S13.2.60.2.a - transect 2, repeat 2, age 113 years, surface depth) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 16602 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Midre Lovenbreen, Svalbard, Norway | |||||||
| Coordinates | Lat. (o) | 78.99166667 | Long. (o) | 12.23 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049665 | Metagenome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137482_1000589 | F049665 | GAG | MSVRLKAIYKDGAFVPITNGDKLNVPENSEVELTVHNPYIIPPKAKSEEERQRALRELFASWDAHPLRADAPRLTRDEMHERR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |