Basic Information | |
---|---|
Taxon OID | 3300011196 Open in IMG/M |
Scaffold ID | Ga0137482_100058 Open in IMG/M |
Source Dataset Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 17 - S13.2.60.2.a - transect 2, repeat 2, age 113 years, surface depth) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 16602 |
Total Scaffold Genes | 15 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Midre Lovenbreen, Svalbard, Norway | |||||||
Coordinates | Lat. (o) | 78.99166667 | Long. (o) | 12.23 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049665 | Metagenome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137482_1000589 | F049665 | GAG | MSVRLKAIYKDGAFVPITNGDKLNVPENSEVELTVHNPYIIPPKAKSEEERQRALRELFASWDAHPLRADAPRLTRDEMHERR* |
⦗Top⦘ |