Basic Information | |
---|---|
Taxon OID | 3300010390 Open in IMG/M |
Scaffold ID | Ga0136854_164119 Open in IMG/M |
Source Dataset Name | Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA ? sample A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Leibniz Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1258 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.619 | Long. (o) | -121.9 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043080 | Metagenome / Metatranscriptome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136854_1641193 | F043080 | AGGAGG | MTNTNNTNTMTVYTGTFVTQRGEQRTMNFVRISEAPDGVFPMNLRERNLKAGYETVWDIDRQQYRTFNSNTQIGSISSSSRDVSIRLF* |
⦗Top⦘ |