Basic Information | |
---|---|
Taxon OID | 3300010229 Open in IMG/M |
Scaffold ID | Ga0136218_1010840 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Fidelity Systems Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 914 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bangor area, North Wales, UK | |||||||
Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065625 | Metagenome / Metatranscriptome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136218_10108402 | F065625 | GAG | MLRAAGGDPYGPRDLDEWRVRHSGLHPHTTLLSALRAQYDELTLEWVPYFHRWLGGPSSEALEQTLIGAGAIPAIGYRWAGASTSTTRSSAPSR* |
⦗Top⦘ |