NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118737_1024300

Scaffold Ga0118737_1024300


Overview

Basic Information
Taxon OID3300009379 Open in IMG/M
Scaffold IDGa0118737_1024300 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 1 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1028
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameBaltimore Canyon, US Atlantic Margin
CoordinatesLat. (o)38.05018333Long. (o)-73.82193333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065254Metagenome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0118737_10243002F065254N/ALWNAPVALNKGSEQAEKASVATETLLWGCPITNFKATLPYNRMGQLFAAFKKRLHDPALERFKGYN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.