NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123226_10024

Scaffold Ga0123226_10024


Overview

Basic Information
Taxon OID3300009292 Open in IMG/M
Scaffold IDGa0123226_10024 Open in IMG/M
Source Dataset NameEstuarine microbial communities from Mobile Bay, Alabama - Sample Wi re-assembly with CLC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAuburn University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)542
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From Mobile Bay, Alabama

Source Dataset Sampling Location
Location NameMobile Bay, Alabama
CoordinatesLat. (o)30.4464641Long. (o)-87.9922684Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010726Metagenome / Metatranscriptome300Y

Sequences

Protein IDFamilyRBSSequence
Ga0123226_100242F010726N/AMKLVFALIVLIDGTVDAEATSYWHDITRCRWFAEELTIQGTIRRYDTPVHAYCKPVYVDPAE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.