| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009292 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111465 | Gp0106795 | Ga0123226 |
| Sample Name | Estuarine microbial communities from Mobile Bay, Alabama - Sample Wi re-assembly with CLC |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Auburn University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 287010 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Estuarine Microbial Communities From Mobile Bay, Alabama |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From Mobile Bay, Alabama |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | estuarine biome → estuary → estuarine water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mobile Bay, Alabama | |||||||
| Coordinates | Lat. (o) | 30.4464641 | Long. (o) | -87.9922684 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010726 | Metagenome / Metatranscriptome | 300 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0123226_10024 | Not Available | 542 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0123226_10024 | Ga0123226_100242 | F010726 | MKLVFALIVLIDGTVDAEATSYWHDITRCRWFAEELTIQGTIRRYDTPVHAYCKPVYVDPAE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |