Basic Information | |
---|---|
Taxon OID | 3300008988 Open in IMG/M |
Scaffold ID | Ga0116025_10019727 Open in IMG/M |
Source Dataset Name | Combined Assembly of De NOVO T65 T0 (live) Oil Sands Gp0125710, Gp0125712, Gp0125662 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 987 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alberta, Canada | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096266 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116025_100197273 | F096266 | GAGG | MMVDARFVFMLLTGVMLAALIVITIVTYSKKRKQKLEEPKHKMLEDD* |
⦗Top⦘ |