| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008988 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117890 | Gp0125662 | Ga0116025 |
| Sample Name | Combined Assembly of De NOVO T65 T0 (live) Oil Sands Gp0125710, Gp0125712, Gp0125662 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 206391355 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059711 | Metagenome | 133 | Y |
| F096266 | Metagenome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116025_10013643 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| Ga0116025_10019727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 987 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116025_10013643 | Ga0116025_100136433 | F059711 | MRERTLHTSINLLLDPDTYQRIKMIATLQKIPMSKFIREGINLRLAQYDKENNSVIGGKDRGRTDNQ* |
| Ga0116025_10019727 | Ga0116025_100197273 | F096266 | MMVDARFVFMLLTGVMLAALIVITIVTYSKKRKQKLEEPKHKMLEDD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |