Basic Information | |
---|---|
Taxon OID | 3300008955 Open in IMG/M |
Scaffold ID | Ga0104273_100539 Open in IMG/M |
Source Dataset Name | Marine bacterioplankton communities from the North Sea island Helgoland off the German coast - probe E228 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Marine Microbiology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 894 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Marine Bacterioplankton Communities From The North Sea Island Helgoland Off The German Coast |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Sea off the coast of Germany | |||||||
Coordinates | Lat. (o) | 54.18194 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000751 | Metagenome / Metatranscriptome | 907 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104273_1005392 | F000751 | N/A | MNIYKTNFPTEQEGKDYLLSIGVLVETDNEIVFSKDTAAVVYIGKVVKIPATYDADGNIITPAVYYDGYAIDVMSSLDLDFGAFMVYPIEAAHSFYGYARNAEVPK* |
⦗Top⦘ |