NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104273_100539

Scaffold Ga0104273_100539


Overview

Basic Information
Taxon OID3300008955 Open in IMG/M
Scaffold IDGa0104273_100539 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from the North Sea island Helgoland off the German coast - probe E228
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Marine Microbiology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)894
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Marine Bacterioplankton Communities From The North Sea Island Helgoland Off The German Coast

Source Dataset Sampling Location
Location NameNorth Sea off the coast of Germany
CoordinatesLat. (o)54.18194Long. (o)7.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000751Metagenome / Metatranscriptome907Y

Sequences

Protein IDFamilyRBSSequence
Ga0104273_1005392F000751N/AMNIYKTNFPTEQEGKDYLLSIGVLVETDNEIVFSKDTAAVVYIGKVVKIPATYDADGNIITPAVYYDGYAIDVMSSLDLDFGAFMVYPIEAAHSFYGYARNAEVPK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.