NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104273_100247

Scaffold Ga0104273_100247


Overview

Basic Information
Taxon OID3300008955 Open in IMG/M
Scaffold IDGa0104273_100247 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from the North Sea island Helgoland off the German coast - probe E228
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Marine Microbiology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1305
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Marine Bacterioplankton Communities From The North Sea Island Helgoland Off The German Coast

Source Dataset Sampling Location
Location NameNorth Sea off the coast of Germany
CoordinatesLat. (o)54.18194Long. (o)7.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019836Metagenome / Metatranscriptome227Y
F045764Metagenome / Metatranscriptome152N
F062159Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0104273_1002472F019836N/AMQKAELELPVKQFHRLYDLLGDILDHEAETNDFNMENNDIELIEDIRTELFNQIPDEKTYTDYAVTGRSSNPSIQAGKLYKIVEQTSKHGFKLEVEDGEVIYCLFKNCAFLNGRDWTIINVEN*
Ga0104273_1002473F045764N/AMKLTDEEIKEIADRMDDLMWEGFHDIVDDVYRQREDSSYDYEIWDEDIIKVRKELKKCL*
Ga0104273_1002474F062159N/AMPIIMKNLTEEYVNIDWSGICEDFDLEYGDISPEQSFEIDRALGNINEILHDFINQNK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.