


| Basic Information | |
|---|---|
| Taxon OID | 3300008789 Open in IMG/M |
| Scaffold ID | Ga0103689_1002835 Open in IMG/M |
| Source Dataset Name | Microbial communities of hydrothermal vent plumes from the Guaymas Basin in the Gulf of California - Background GD7i |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent In Guaymas Basin In The Gulf Of California → Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymas Basin in the Gulf of California | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098669 | Metagenome / Metatranscriptome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103689_10028351 | F098669 | GAG | METATRGRKQKWRLKEAEGLGRKRRIEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVRFRP |
| ⦗Top⦘ |