| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008789 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117961 | Gp0126278 | Ga0103689 |
| Sample Name | Microbial communities of hydrothermal vent plumes from the Guaymas Basin in the Gulf of California - Background GD7i |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 29233890 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent In Guaymas Basin In The Gulf Of California → Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal plume → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Guaymas Basin in the Gulf of California | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000075 | Metagenome / Metatranscriptome | 2622 | Y |
| F098669 | Metagenome / Metatranscriptome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103689_1002835 | Not Available | 513 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103689_1002835 | Ga0103689_10028351 | F098669 | METATRGRKQKWRLKEAEGLGRKRRIEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVRFRP |
| Ga0103689_1002943 | Ga0103689_10029431 | F000075 | AVAANQYDSMNEDELLVSLESTLSSAQRSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |