


| Basic Information | |
|---|---|
| Taxon OID | 3300007351 Open in IMG/M |
| Scaffold ID | Ga0104751_1048244 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0115775, Gp0115815 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Aeronautics and Space Administration (NASA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2083 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Deep Subsurface Aquifer Microbial Community From Lead, South Dakota |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lead, South Dakota, USA | |||||||
| Coordinates | Lat. (o) | 44.03416667 | Long. (o) | -103.76583333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048673 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104751_10482444 | F048673 | AGGAG | MRTFAMLLILVAIAASQPHHWLTVLMAAIAHCIGK* |
| ⦗Top⦘ |