Basic Information | |
---|---|
Taxon OID | 3300007289 Open in IMG/M |
Scaffold ID | Ga0104734_1026752 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from aeration tank of chemical wastewater treatment plant in Ankleshwar, Gujarat, India ? sample Ank1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Xcelris Genomics |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5481 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aeration Tank Of Activted Sludge Process → Activated Sludge Process Metagenomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gujarat, Ankleshwar, India | |||||||
Coordinates | Lat. (o) | 21.6266027 | Long. (o) | 73.0119202 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034990 | Metagenome / Metatranscriptome | 173 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104734_10267528 | F034990 | N/A | MEAYNVKQGTKVIIIDDDVKTPPDSISVKKGDEITIDRLDGMYCNGINSNGDRIYIAAWTEVQLY* |
⦗Top⦘ |