NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007289

3300007289: Activated sludge microbial communities from aeration tank of chemical wastewater treatment plant in Ankleshwar, Gujarat, India ? sample Ank1



Overview

Basic Information
IMG/M Taxon OID3300007289 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118053 | Gp0127450 | Ga0104734
Sample NameActivated sludge microbial communities from aeration tank of chemical wastewater treatment plant in Ankleshwar, Gujarat, India ? sample Ank1
Sequencing StatusPermanent Draft
Sequencing CenterXcelris Genomics
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size137189454
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Process Metagenomes
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Aeration Tank Of Activted Sludge Process → Activated Sludge Process Metagenomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomewastewater treatment plantactivated sludge
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationGujarat, Ankleshwar, India
CoordinatesLat. (o)21.6266027Long. (o)73.0119202Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015419Metagenome / Metatranscriptome255Y
F034990Metagenome / Metatranscriptome173Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104734_1025113All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2982Open in IMG/M
Ga0104734_1026752All Organisms → cellular organisms → Bacteria5481Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104734_1025113Ga0104734_10251137F015419MKLELKITDEHGNEHLYNVVRSSSDEPKNLNDFILEALSISEDKRQLPFLIQCPNGLEVYPSIKMKFENYGSSLLGDKLEAMMVTWRD*
Ga0104734_1026752Ga0104734_10267528F034990MEAYNVKQGTKVIIIDDDVKTPPDSISVKKGDEITIDRLDGMYCNGINSNGDRIYIAAWTEVQLY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.