NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098035_1058127

Scaffold Ga0098035_1058127


Overview

Basic Information
Taxon OID3300006738 Open in IMG/M
Scaffold IDGa0098035_1058127 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1399
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-13.003Long. (o)-80.809Alt. (m)Depth (m)135
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F003592Metagenome / Metatranscriptome478Y
F013703Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0098035_10581271F003592GAGGMRFKKYYKDIISLIASLSLLGTVYFVNHYDIKQLYREFVGLRLKVQSQEKTIGDLKNEIKQYRDLYSSLQSELETHNKERGEENALLFKELEDLKYKVEVLSMKSTLSSNISGNDRFEFTDKQVNRVGQYETKGQVLVAWKDDYLTTKKVNVNTIGEINLSPKIEKLSKKEFVSYIDETYVGGITIRGRGEIQQIEPPRNQFSFGPFIGVAYNNSTG
Ga0098035_10581272F001319AGGAGMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098035_10581273F013703N/ATVNLQTFVSYTIFRYYEGLNTENKYLLLESPILIYPGFNVDFKFTETFKMNFGFNVGYNTLVNDLGKRNINYSIIFGTNF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.