NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F001319

Metagenome / Metatranscriptome Family F001319

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F001319
Family Type Metagenome / Metatranscriptome
Number of Sequences 723
Average Sequence Length 165 residues
Representative Sequence MKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Number of Associated Samples 443
Number of Associated Scaffolds 723

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.66 %
% of genes near scaffold ends (potentially truncated) 50.21 %
% of genes from short scaffolds (< 2000 bps) 77.32 %
Associated GOLD sequencing projects 356
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.934 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.896 % of family members)
Environment Ontology (ENVO) Unclassified
(76.210 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.393 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 22.11%    β-sheet: 31.66%    Coil/Unstructured: 46.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 723 Family Scaffolds
PF00293NUDIX 5.12
PF01467CTP_transf_like 2.21
PF00037Fer4 1.94
PF01569PAP2 1.38
PF12838Fer4_7 1.38
PF13392HNH_3 0.69
PF07883Cupin_2 0.14
PF13733Glyco_transf_7N 0.14
PF00149Metallophos 0.14
PF03237Terminase_6N 0.14
PF10124Mu-like_gpT 0.14
PF06114Peptidase_M78 0.14



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.72 %
UnclassifiedrootN/A0.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10030418All Organisms → Viruses → Predicted Viral2978Open in IMG/M
3300000101|DelMOSum2010_c10076934All Organisms → Viruses → Predicted Viral1500Open in IMG/M
3300000101|DelMOSum2010_c10114460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1079Open in IMG/M
3300000115|DelMOSum2011_c10035848All Organisms → Viruses → Predicted Viral2133Open in IMG/M
3300000115|DelMOSum2011_c10049324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1679Open in IMG/M
3300000115|DelMOSum2011_c10061164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1415Open in IMG/M
3300000115|DelMOSum2011_c10103471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium928Open in IMG/M
3300000117|DelMOWin2010_c10011990All Organisms → Viruses → Predicted Viral4848Open in IMG/M
3300000117|DelMOWin2010_c10023491All Organisms → Viruses → Predicted Viral3152Open in IMG/M
3300000117|DelMOWin2010_c10088680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1176Open in IMG/M
3300000117|DelMOWin2010_c10113798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium961Open in IMG/M
3300000117|DelMOWin2010_c10213925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium585Open in IMG/M
3300001344|JGI20152J14361_10026604All Organisms → Viruses → Predicted Viral1980Open in IMG/M
3300001344|JGI20152J14361_10049249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1128Open in IMG/M
3300001344|JGI20152J14361_10106083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium553Open in IMG/M
3300001344|JGI20152J14361_10108490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium542Open in IMG/M
3300001344|JGI20152J14361_10109296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium539Open in IMG/M
3300001346|JGI20151J14362_10119938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium852Open in IMG/M
3300001346|JGI20151J14362_10128987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium799Open in IMG/M
3300001355|JGI20158J14315_10063019All Organisms → Viruses → Predicted Viral1465Open in IMG/M
3300001355|JGI20158J14315_10168897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium650Open in IMG/M
3300001355|JGI20158J14315_10199296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium572Open in IMG/M
3300001355|JGI20158J14315_10212599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium545Open in IMG/M
3300001450|JGI24006J15134_10002444All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium10215Open in IMG/M
3300001450|JGI24006J15134_10031513All Organisms → Viruses → Predicted Viral2320Open in IMG/M
3300001450|JGI24006J15134_10220909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium563Open in IMG/M
3300001460|JGI24003J15210_10070955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1086Open in IMG/M
3300001460|JGI24003J15210_10084760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium948Open in IMG/M
3300001460|JGI24003J15210_10177709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium518Open in IMG/M
3300001472|JGI24004J15324_10029746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1783Open in IMG/M
3300001683|GBIDBA_10011700All Organisms → Viruses → Predicted Viral4774Open in IMG/M
3300001942|GOS2262_1013631All Organisms → Viruses → Predicted Viral2034Open in IMG/M
3300001943|GOS2226_1028276All Organisms → Viruses → Predicted Viral1507Open in IMG/M
3300001956|GOS2266_1032998All Organisms → Viruses → Predicted Viral1699Open in IMG/M
3300001965|GOS2243_1034084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1713Open in IMG/M
3300002231|KVRMV2_100178241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium766Open in IMG/M
3300002242|KVWGV2_10662771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium545Open in IMG/M
3300002482|JGI25127J35165_1017952All Organisms → Viruses → Predicted Viral1738Open in IMG/M
3300002482|JGI25127J35165_1125992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300002483|JGI25132J35274_1019397All Organisms → Viruses → Predicted Viral1615Open in IMG/M
3300002483|JGI25132J35274_1020620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1557Open in IMG/M
3300002483|JGI25132J35274_1028107All Organisms → Viruses → Predicted Viral1290Open in IMG/M
3300002483|JGI25132J35274_1047907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium930Open in IMG/M
3300002483|JGI25132J35274_1060924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium802Open in IMG/M
3300002488|JGI25128J35275_1031342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1238Open in IMG/M
3300002488|JGI25128J35275_1040784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1038Open in IMG/M
3300002488|JGI25128J35275_1046567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium954Open in IMG/M
3300002488|JGI25128J35275_1049933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium912Open in IMG/M
3300002514|JGI25133J35611_10085639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium959Open in IMG/M
3300003474|NAP4_1028560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1048Open in IMG/M
3300003476|NAP2_1030747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1074Open in IMG/M
3300003478|JGI26238J51125_1033753All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300004097|Ga0055584_100902351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium925Open in IMG/M
3300005239|Ga0073579_1189969Not Available54112Open in IMG/M
3300005404|Ga0066856_10175965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium933Open in IMG/M
3300005404|Ga0066856_10319285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium668Open in IMG/M
3300005427|Ga0066851_10155344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium729Open in IMG/M
3300005430|Ga0066849_10035995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2003Open in IMG/M
3300005512|Ga0074648_1169427All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Borreliaceae → Borrelia → Borrelia hispanica638Open in IMG/M
3300005514|Ga0066866_10244907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium621Open in IMG/M
3300005521|Ga0066862_10121906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium884Open in IMG/M
3300005523|Ga0066865_10130705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium923Open in IMG/M
3300005606|Ga0066835_10118481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium859Open in IMG/M
3300005611|Ga0074647_1033486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium689Open in IMG/M
3300006025|Ga0075474_10013316All Organisms → Viruses → Predicted Viral3088Open in IMG/M
3300006025|Ga0075474_10023018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2240Open in IMG/M
3300006026|Ga0075478_10115603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium850Open in IMG/M
3300006027|Ga0075462_10222042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium564Open in IMG/M
3300006164|Ga0075441_10009374All Organisms → Viruses → Predicted Viral4179Open in IMG/M
3300006164|Ga0075441_10011651All Organisms → cellular organisms → Bacteria3724Open in IMG/M
3300006164|Ga0075441_10067641All Organisms → Viruses → Predicted Viral1395Open in IMG/M
3300006166|Ga0066836_10036671All Organisms → Viruses → Predicted Viral2768Open in IMG/M
3300006190|Ga0075446_10236149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium506Open in IMG/M
3300006305|Ga0068468_1029257All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium560Open in IMG/M
3300006308|Ga0068470_1702938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1201Open in IMG/M
3300006329|Ga0068486_1085869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium842Open in IMG/M
3300006332|Ga0068500_1166579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1653Open in IMG/M
3300006345|Ga0099693_1047417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium749Open in IMG/M
3300006345|Ga0099693_1107002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium764Open in IMG/M
3300006350|Ga0099954_1023733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2779Open in IMG/M
3300006357|Ga0075502_1614846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium826Open in IMG/M
3300006397|Ga0075488_1461286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium996Open in IMG/M
3300006401|Ga0075506_1715868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium927Open in IMG/M
3300006565|Ga0100228_1027291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1454Open in IMG/M
3300006565|Ga0100228_1029032All Organisms → Viruses → Predicted Viral2146Open in IMG/M
3300006565|Ga0100228_1205606All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium737Open in IMG/M
3300006637|Ga0075461_10215091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium572Open in IMG/M
3300006735|Ga0098038_1010145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3701Open in IMG/M
3300006735|Ga0098038_1021984All Organisms → Viruses → Predicted Viral2422Open in IMG/M
3300006735|Ga0098038_1023129All Organisms → Viruses → Predicted Viral2355Open in IMG/M
3300006735|Ga0098038_1093420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1043Open in IMG/M
3300006735|Ga0098038_1156058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium758Open in IMG/M
3300006735|Ga0098038_1239638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium576Open in IMG/M
3300006737|Ga0098037_1007625All Organisms → Viruses → Predicted Viral4311Open in IMG/M
3300006737|Ga0098037_1013807All Organisms → cellular organisms → Bacteria3086Open in IMG/M
3300006737|Ga0098037_1015955All Organisms → Viruses → Predicted Viral2844Open in IMG/M
3300006737|Ga0098037_1183049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium692Open in IMG/M
3300006737|Ga0098037_1211026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium633Open in IMG/M
3300006738|Ga0098035_1058127All Organisms → Viruses → Predicted Viral1399Open in IMG/M
3300006749|Ga0098042_1004803All Organisms → Viruses → Predicted Viral4613Open in IMG/M
3300006749|Ga0098042_1080321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium845Open in IMG/M
3300006749|Ga0098042_1156808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium556Open in IMG/M
3300006750|Ga0098058_1079559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium899Open in IMG/M
3300006752|Ga0098048_1085120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium964Open in IMG/M
3300006753|Ga0098039_1020966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2354Open in IMG/M
3300006754|Ga0098044_1018623All Organisms → Viruses → Predicted Viral3141Open in IMG/M
3300006754|Ga0098044_1252277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium683Open in IMG/M
3300006793|Ga0098055_1018059All Organisms → Viruses → Predicted Viral3048Open in IMG/M
3300006802|Ga0070749_10367687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium797Open in IMG/M
3300006802|Ga0070749_10745176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300006810|Ga0070754_10306770All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Borreliaceae → Borrelia → Borrelia crocidurae711Open in IMG/M
3300006868|Ga0075481_10097539All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300006869|Ga0075477_10011111All Organisms → Viruses → Predicted Viral4250Open in IMG/M
3300006869|Ga0075477_10178040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium878Open in IMG/M
3300006874|Ga0075475_10008092All Organisms → cellular organisms → Bacteria5335Open in IMG/M
3300006900|Ga0066376_10018217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium4943Open in IMG/M
3300006916|Ga0070750_10067623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1699Open in IMG/M
3300006916|Ga0070750_10325265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium653Open in IMG/M
3300006921|Ga0098060_1185906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium570Open in IMG/M
3300006922|Ga0098045_1033780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1309Open in IMG/M
3300006924|Ga0098051_1128175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium675Open in IMG/M
3300006925|Ga0098050_1038342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1284Open in IMG/M
3300006925|Ga0098050_1040857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1238Open in IMG/M
3300006925|Ga0098050_1067982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium925Open in IMG/M
3300006925|Ga0098050_1089155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium792Open in IMG/M
3300006928|Ga0098041_1052007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1326Open in IMG/M
3300006928|Ga0098041_1077351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1074Open in IMG/M
3300006928|Ga0098041_1173189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium692Open in IMG/M
3300006928|Ga0098041_1209199All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium624Open in IMG/M
3300006928|Ga0098041_1248540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium567Open in IMG/M
3300006929|Ga0098036_1055689All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300006929|Ga0098036_1102807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium878Open in IMG/M
3300006929|Ga0098036_1125319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium787Open in IMG/M
3300006947|Ga0075444_10330935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium583Open in IMG/M
3300006990|Ga0098046_1055307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium921Open in IMG/M
3300007113|Ga0101666_1100529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium535Open in IMG/M
3300007114|Ga0101668_1116477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium572Open in IMG/M
3300007229|Ga0075468_10005827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5055Open in IMG/M
3300007231|Ga0075469_10017065All Organisms → Viruses → Predicted Viral2526Open in IMG/M
3300007234|Ga0075460_10012469All Organisms → Viruses → Predicted Viral3387Open in IMG/M
3300007234|Ga0075460_10055256All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300007276|Ga0070747_1063041All Organisms → Viruses → Predicted Viral1405Open in IMG/M
3300007346|Ga0070753_1008612All Organisms → Viruses → Predicted Viral4925Open in IMG/M
3300007514|Ga0105020_1031222All Organisms → Viruses → Predicted Viral4855Open in IMG/M
3300007538|Ga0099851_1107929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1057Open in IMG/M
3300007538|Ga0099851_1138991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium910Open in IMG/M
3300007540|Ga0099847_1004192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium4915Open in IMG/M
3300007544|Ga0102861_1046253All Organisms → Viruses → Predicted Viral1126Open in IMG/M
3300007623|Ga0102948_1083037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium995Open in IMG/M
3300007647|Ga0102855_1155569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium611Open in IMG/M
3300007725|Ga0102951_1114935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium761Open in IMG/M
3300007778|Ga0102954_1058938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1065Open in IMG/M
3300007960|Ga0099850_1061700All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1583Open in IMG/M
3300007963|Ga0110931_1069399All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300008012|Ga0075480_10027380All Organisms → Viruses → Predicted Viral3468Open in IMG/M
3300008012|Ga0075480_10263394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium887Open in IMG/M
3300008050|Ga0098052_1086922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1289Open in IMG/M
3300008050|Ga0098052_1097407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1201Open in IMG/M
3300008050|Ga0098052_1281267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium631Open in IMG/M
3300008050|Ga0098052_1398996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium511Open in IMG/M
3300008216|Ga0114898_1124754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium754Open in IMG/M
3300008216|Ga0114898_1219236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium521Open in IMG/M
3300008219|Ga0114905_1259514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium544Open in IMG/M
3300008999|Ga0102816_1006997All Organisms → Viruses → Predicted Viral3237Open in IMG/M
3300009000|Ga0102960_1069577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1290Open in IMG/M
3300009000|Ga0102960_1095913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1081Open in IMG/M
3300009000|Ga0102960_1133431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium898Open in IMG/M
3300009000|Ga0102960_1287947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium580Open in IMG/M
3300009001|Ga0102963_1018170All Organisms → Viruses → Predicted Viral2969Open in IMG/M
3300009001|Ga0102963_1219556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium756Open in IMG/M
3300009001|Ga0102963_1249949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium702Open in IMG/M
3300009002|Ga0102810_1042268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1480Open in IMG/M
3300009026|Ga0102829_1147227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium752Open in IMG/M
3300009027|Ga0102957_1228245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium671Open in IMG/M
3300009051|Ga0102864_1143286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium653Open in IMG/M
3300009058|Ga0102854_1088702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium885Open in IMG/M
3300009071|Ga0115566_10284550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium979Open in IMG/M
3300009071|Ga0115566_10839722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300009074|Ga0115549_1063009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1293Open in IMG/M
3300009074|Ga0115549_1087588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1054Open in IMG/M
3300009076|Ga0115550_1047742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1773Open in IMG/M
3300009077|Ga0115552_1401443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium541Open in IMG/M
3300009079|Ga0102814_10741516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium541Open in IMG/M
3300009124|Ga0118687_10037474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1604Open in IMG/M
3300009124|Ga0118687_10126658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium900Open in IMG/M
3300009173|Ga0114996_10096035All Organisms → Viruses → Predicted Viral2527Open in IMG/M
3300009173|Ga0114996_10149877All Organisms → Viruses → Predicted Viral1922Open in IMG/M
3300009173|Ga0114996_10170659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1777Open in IMG/M
3300009193|Ga0115551_1432110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium564Open in IMG/M
3300009409|Ga0114993_10494210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium910Open in IMG/M
3300009418|Ga0114908_1161360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium714Open in IMG/M
3300009420|Ga0114994_11125886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium506Open in IMG/M
3300009423|Ga0115548_1086725All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1039Open in IMG/M
3300009425|Ga0114997_10100642All Organisms → Viruses → Predicted Viral1765Open in IMG/M
3300009433|Ga0115545_1113659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium970Open in IMG/M
3300009433|Ga0115545_1250317All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium595Open in IMG/M
3300009433|Ga0115545_1327728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium507Open in IMG/M
3300009434|Ga0115562_1122885All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium997Open in IMG/M
3300009435|Ga0115546_1265104All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium588Open in IMG/M
3300009436|Ga0115008_10087643All Organisms → Viruses → Predicted Viral2330Open in IMG/M
3300009438|Ga0115559_1062765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1548Open in IMG/M
3300009440|Ga0115561_1147993All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium923Open in IMG/M
3300009442|Ga0115563_1090960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1324Open in IMG/M
3300009442|Ga0115563_1129564All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300009443|Ga0115557_1013212All Organisms → Viruses → Predicted Viral4477Open in IMG/M
3300009447|Ga0115560_1034901All Organisms → Viruses → Predicted Viral2326Open in IMG/M
3300009449|Ga0115558_1014946All Organisms → Viruses → Predicted Viral3925Open in IMG/M
3300009449|Ga0115558_1420134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium520Open in IMG/M
3300009449|Ga0115558_1420135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium520Open in IMG/M
3300009467|Ga0115565_10048542All Organisms → Viruses → Predicted Viral2088Open in IMG/M
3300009467|Ga0115565_10146693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1101Open in IMG/M
3300009472|Ga0115554_1034036All Organisms → Viruses → Predicted Viral2442Open in IMG/M
3300009472|Ga0115554_1255141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium700Open in IMG/M
3300009481|Ga0114932_10012498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium6336Open in IMG/M
3300009481|Ga0114932_10096765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1840Open in IMG/M
3300009481|Ga0114932_10145433All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1459Open in IMG/M
3300009481|Ga0114932_10217853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1158Open in IMG/M
3300009496|Ga0115570_10026147All Organisms → Viruses → Predicted Viral3379Open in IMG/M
3300009496|Ga0115570_10033496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2882Open in IMG/M
3300009497|Ga0115569_10063424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1982Open in IMG/M
3300009505|Ga0115564_10421170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium650Open in IMG/M
3300009508|Ga0115567_10912037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium521Open in IMG/M
3300009512|Ga0115003_10055050All Organisms → Viruses → Predicted Viral2511Open in IMG/M
3300009512|Ga0115003_10513731All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium701Open in IMG/M
3300009550|Ga0115013_10372083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium904Open in IMG/M
3300009593|Ga0115011_10041610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3122Open in IMG/M
3300009593|Ga0115011_10203802All Organisms → Viruses → Predicted Viral1463Open in IMG/M
3300009593|Ga0115011_10302428All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300009593|Ga0115011_11539937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium589Open in IMG/M
3300009619|Ga0105236_1033843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium638Open in IMG/M
3300009677|Ga0115104_10438448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1054Open in IMG/M
3300009677|Ga0115104_10538643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium531Open in IMG/M
3300009677|Ga0115104_10540064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium622Open in IMG/M
3300009679|Ga0115105_10003310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium986Open in IMG/M
3300009703|Ga0114933_10187006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1409Open in IMG/M
3300009703|Ga0114933_10208819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1320Open in IMG/M
3300009703|Ga0114933_10375928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium934Open in IMG/M
3300009705|Ga0115000_10012089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium6404Open in IMG/M
3300009705|Ga0115000_10818607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium571Open in IMG/M
3300009706|Ga0115002_10091385All Organisms → Viruses → Predicted Viral2509Open in IMG/M
3300009786|Ga0114999_10081214All Organisms → Viruses → Predicted Viral2867Open in IMG/M
3300009786|Ga0114999_11289351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium518Open in IMG/M
3300009790|Ga0115012_11125209All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium656Open in IMG/M
3300010148|Ga0098043_1040564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1444Open in IMG/M
3300010148|Ga0098043_1045482All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300010148|Ga0098043_1058322All Organisms → Viruses → Predicted Viral1169Open in IMG/M
3300010148|Ga0098043_1104624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium824Open in IMG/M
3300010148|Ga0098043_1175389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium600Open in IMG/M
3300010149|Ga0098049_1038648All Organisms → Viruses → Predicted Viral1539Open in IMG/M
3300010149|Ga0098049_1052088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1306Open in IMG/M
3300010149|Ga0098049_1083054All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300010149|Ga0098049_1222455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium576Open in IMG/M
3300010150|Ga0098056_1023952All Organisms → Viruses → Predicted Viral2163Open in IMG/M
3300010150|Ga0098056_1028700All Organisms → Viruses → Predicted Viral1957Open in IMG/M
3300010150|Ga0098056_1128047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium861Open in IMG/M
3300010150|Ga0098056_1299601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium530Open in IMG/M
3300010150|Ga0098056_1324076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium506Open in IMG/M
3300010153|Ga0098059_1028295All Organisms → Viruses → Predicted Viral2279Open in IMG/M
3300010155|Ga0098047_10285546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium624Open in IMG/M
3300010368|Ga0129324_10099760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1254Open in IMG/M
3300010368|Ga0129324_10181641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium863Open in IMG/M
3300011128|Ga0151669_130882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium565Open in IMG/M
3300011252|Ga0151674_1062783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium917Open in IMG/M
3300011252|Ga0151674_1062784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium930Open in IMG/M
3300011253|Ga0151671_1040368All Organisms → Viruses → Predicted Viral1582Open in IMG/M
3300011253|Ga0151671_1040369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium745Open in IMG/M
3300011258|Ga0151677_1020201All Organisms → Viruses → Predicted Viral3609Open in IMG/M
3300012504|Ga0129347_1134134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium585Open in IMG/M
3300012919|Ga0160422_10599430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium698Open in IMG/M
3300012919|Ga0160422_10601271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium697Open in IMG/M
3300012919|Ga0160422_10720275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium637Open in IMG/M
3300012920|Ga0160423_10004684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium11211Open in IMG/M
3300012920|Ga0160423_10108695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1957Open in IMG/M
3300012920|Ga0160423_10134499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1739Open in IMG/M
3300012920|Ga0160423_10149663All Organisms → Viruses → Predicted Viral1638Open in IMG/M
3300012920|Ga0160423_10515981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium812Open in IMG/M
3300012920|Ga0160423_10581980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium759Open in IMG/M
3300012920|Ga0160423_10650014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium713Open in IMG/M
3300012920|Ga0160423_10748235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium658Open in IMG/M
3300012920|Ga0160423_10858413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium610Open in IMG/M
3300012920|Ga0160423_11109582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium529Open in IMG/M
3300012920|Ga0160423_11183000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium510Open in IMG/M
3300012928|Ga0163110_10232850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1320Open in IMG/M
3300012928|Ga0163110_10487948All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium937Open in IMG/M
3300012928|Ga0163110_10912224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium696Open in IMG/M
3300012928|Ga0163110_11077890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium642Open in IMG/M
3300012928|Ga0163110_11442671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium557Open in IMG/M
3300012928|Ga0163110_11509181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium545Open in IMG/M
3300012928|Ga0163110_11610014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium528Open in IMG/M
3300012928|Ga0163110_11647699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300012936|Ga0163109_10164923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1627Open in IMG/M
3300012936|Ga0163109_10170107All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300012936|Ga0163109_10189884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1509Open in IMG/M
3300012936|Ga0163109_10332838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1112Open in IMG/M
3300012936|Ga0163109_11050375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium595Open in IMG/M
3300012952|Ga0163180_10321937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1106Open in IMG/M
3300012953|Ga0163179_10007249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7293Open in IMG/M
3300012953|Ga0163179_10025701All Organisms → Viruses → Predicted Viral3935Open in IMG/M
3300012953|Ga0163179_10036998All Organisms → Viruses → Predicted Viral3313Open in IMG/M
3300012954|Ga0163111_10481548All Organisms → Viruses → Predicted Viral1140Open in IMG/M
3300012954|Ga0163111_11215018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium736Open in IMG/M
3300012954|Ga0163111_11522240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium662Open in IMG/M
3300012954|Ga0163111_12391800All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium537Open in IMG/M
3300012954|Ga0163111_12696768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium507Open in IMG/M
3300012963|Ga0129340_1157746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium552Open in IMG/M
3300014973|Ga0134293_1006340All Organisms → Viruses → Predicted Viral2124Open in IMG/M
3300016739|Ga0182076_1480484All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium981Open in IMG/M
3300016741|Ga0182079_1398608All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium596Open in IMG/M
3300016787|Ga0182080_1526569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium667Open in IMG/M
3300017697|Ga0180120_10165411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium931Open in IMG/M
3300017706|Ga0181377_1019394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1503Open in IMG/M
3300017708|Ga0181369_1043566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1021Open in IMG/M
3300017708|Ga0181369_1107268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium577Open in IMG/M
3300017708|Ga0181369_1111462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium562Open in IMG/M
3300017714|Ga0181412_1143017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium541Open in IMG/M
3300017717|Ga0181404_1022227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1635Open in IMG/M
3300017719|Ga0181390_1059726All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300017720|Ga0181383_1096227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium795Open in IMG/M
3300017720|Ga0181383_1133848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium665Open in IMG/M
3300017724|Ga0181388_1062212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium894Open in IMG/M
3300017725|Ga0181398_1021188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1618Open in IMG/M
3300017725|Ga0181398_1084730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium758Open in IMG/M
3300017730|Ga0181417_1161973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium539Open in IMG/M
3300017731|Ga0181416_1170413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium526Open in IMG/M
3300017733|Ga0181426_1027401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1119Open in IMG/M
3300017738|Ga0181428_1044915All Organisms → Viruses → Predicted Viral1029Open in IMG/M
3300017738|Ga0181428_1155947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium533Open in IMG/M
3300017738|Ga0181428_1161351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium524Open in IMG/M
3300017740|Ga0181418_1141978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium577Open in IMG/M
3300017740|Ga0181418_1150316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium559Open in IMG/M
3300017744|Ga0181397_1049507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1165Open in IMG/M
3300017746|Ga0181389_1019039All Organisms → Viruses → Predicted Viral2168Open in IMG/M
3300017748|Ga0181393_1152706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium575Open in IMG/M
3300017749|Ga0181392_1206767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium562Open in IMG/M
3300017750|Ga0181405_1176119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium523Open in IMG/M
3300017751|Ga0187219_1067194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1145Open in IMG/M
3300017757|Ga0181420_1137262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium735Open in IMG/M
3300017758|Ga0181409_1107560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium829Open in IMG/M
3300017760|Ga0181408_1159495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium580Open in IMG/M
3300017762|Ga0181422_1152090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium709Open in IMG/M
3300017764|Ga0181385_1181272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium636Open in IMG/M
3300017764|Ga0181385_1249661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium532Open in IMG/M
3300017764|Ga0181385_1270807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium507Open in IMG/M
3300017765|Ga0181413_1147377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium710Open in IMG/M
3300017767|Ga0181406_1007216All Organisms → Viruses → Predicted Viral3687Open in IMG/M
3300017770|Ga0187217_1076486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1150Open in IMG/M
3300017772|Ga0181430_1045289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1375Open in IMG/M
3300017772|Ga0181430_1070413All Organisms → Viruses → Predicted Viral1065Open in IMG/M
3300017779|Ga0181395_1123481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium823Open in IMG/M
3300017779|Ga0181395_1218974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium587Open in IMG/M
3300017781|Ga0181423_1250109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium663Open in IMG/M
3300017782|Ga0181380_1068227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1254Open in IMG/M
3300017782|Ga0181380_1169460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium739Open in IMG/M
3300017818|Ga0181565_10257683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1182Open in IMG/M
3300017818|Ga0181565_10652741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium671Open in IMG/M
3300017824|Ga0181552_10115041All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300017951|Ga0181577_10060895All Organisms → Viruses → Predicted Viral2666Open in IMG/M
3300017952|Ga0181583_10170837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1441Open in IMG/M
3300017956|Ga0181580_10159589All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300017956|Ga0181580_10582109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium723Open in IMG/M
3300017957|Ga0181571_10730301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium590Open in IMG/M
3300017962|Ga0181581_10451698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium801Open in IMG/M
3300017964|Ga0181589_10041243All Organisms → Viruses → Predicted Viral3496Open in IMG/M
3300017967|Ga0181590_10083274All Organisms → Viruses → Predicted Viral2516Open in IMG/M
3300017967|Ga0181590_10458767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium895Open in IMG/M
3300017968|Ga0181587_10666770All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium659Open in IMG/M
3300017969|Ga0181585_10443291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium879Open in IMG/M
3300017969|Ga0181585_10952278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium549Open in IMG/M
3300017985|Ga0181576_10116427All Organisms → Viruses → Predicted Viral1791Open in IMG/M
3300017985|Ga0181576_10155611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1514Open in IMG/M
3300017986|Ga0181569_10052561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2922Open in IMG/M
3300017986|Ga0181569_10144388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1687Open in IMG/M
3300018049|Ga0181572_10085022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2086Open in IMG/M
3300018049|Ga0181572_10089219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2033Open in IMG/M
3300018049|Ga0181572_10272518All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300018049|Ga0181572_10862581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium537Open in IMG/M
3300018410|Ga0181561_10206034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium961Open in IMG/M
3300018415|Ga0181559_10330527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium845Open in IMG/M
3300018417|Ga0181558_10492250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium639Open in IMG/M
3300018418|Ga0181567_10327503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1025Open in IMG/M
3300018418|Ga0181567_10457387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium839Open in IMG/M
3300018418|Ga0181567_10606271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium707Open in IMG/M
3300018420|Ga0181563_10139365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1539Open in IMG/M
3300018420|Ga0181563_10224872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1131Open in IMG/M
3300018421|Ga0181592_10038882All Organisms → Viruses → Predicted Viral3836Open in IMG/M
3300018421|Ga0181592_10507389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium833Open in IMG/M
3300018421|Ga0181592_10800442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium621Open in IMG/M
3300018421|Ga0181592_10864659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium591Open in IMG/M
3300018423|Ga0181593_11019047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium567Open in IMG/M
3300018424|Ga0181591_10281492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1274Open in IMG/M
3300018426|Ga0181566_10098999All Organisms → Viruses → Predicted Viral2220Open in IMG/M
3300018426|Ga0181566_10251554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1291Open in IMG/M
3300018428|Ga0181568_10393732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1117Open in IMG/M
3300018876|Ga0181564_10469057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium678Open in IMG/M
3300018938|Ga0193542_10034873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium527Open in IMG/M
3300019034|Ga0193543_10051382All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium526Open in IMG/M
3300019280|Ga0182068_1389171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium663Open in IMG/M
3300019751|Ga0194029_1019037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1040Open in IMG/M
3300019751|Ga0194029_1067803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium603Open in IMG/M
3300019756|Ga0194023_1115435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium546Open in IMG/M
3300019938|Ga0194032_1012427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium907Open in IMG/M
3300020054|Ga0181594_10189625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1038Open in IMG/M
3300020165|Ga0206125_10008900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7463Open in IMG/M
3300020165|Ga0206125_10014885All Organisms → cellular organisms → Bacteria5055Open in IMG/M
3300020165|Ga0206125_10082266All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300020166|Ga0206128_1011400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5656Open in IMG/M
3300020166|Ga0206128_1067976All Organisms → Viruses → Predicted Viral1651Open in IMG/M
3300020166|Ga0206128_1090241All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300020169|Ga0206127_1038283All Organisms → Viruses → Predicted Viral2618Open in IMG/M
3300020169|Ga0206127_1270216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium578Open in IMG/M
3300020175|Ga0206124_10015675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3980Open in IMG/M
3300020175|Ga0206124_10129618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1027Open in IMG/M
3300020185|Ga0206131_10211057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium943Open in IMG/M
3300020189|Ga0181578_10234115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium889Open in IMG/M
3300020207|Ga0181570_10037070All Organisms → Viruses → Predicted Viral2960Open in IMG/M
3300020245|Ga0211711_1021589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1078Open in IMG/M
3300020247|Ga0211654_1000406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium8219Open in IMG/M
3300020255|Ga0211586_1005502All Organisms → Viruses → Predicted Viral2821Open in IMG/M
3300020257|Ga0211704_1036519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium723Open in IMG/M
3300020267|Ga0211648_1068445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium677Open in IMG/M
3300020294|Ga0211520_1058377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium612Open in IMG/M
3300020296|Ga0211474_1042092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium720Open in IMG/M
3300020297|Ga0211490_1042344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium817Open in IMG/M
3300020314|Ga0211522_1034478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium916Open in IMG/M
3300020332|Ga0211502_1040334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium916Open in IMG/M
3300020343|Ga0211626_1040321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1219Open in IMG/M
3300020347|Ga0211504_1003748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5651Open in IMG/M
3300020349|Ga0211511_1151552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium518Open in IMG/M
3300020353|Ga0211613_1025152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1377Open in IMG/M
3300020358|Ga0211689_1183700All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium573Open in IMG/M
3300020360|Ga0211712_10025814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1498Open in IMG/M
3300020367|Ga0211703_10072142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium848Open in IMG/M
3300020374|Ga0211477_10009772All Organisms → Viruses → Predicted Viral4798Open in IMG/M
3300020374|Ga0211477_10011517All Organisms → Viruses → Predicted Viral4304Open in IMG/M
3300020374|Ga0211477_10026016All Organisms → Viruses → Predicted Viral2530Open in IMG/M
3300020375|Ga0211656_10150575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium711Open in IMG/M
3300020376|Ga0211682_10130948All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium996Open in IMG/M
3300020377|Ga0211647_10300326All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium500Open in IMG/M
3300020381|Ga0211476_10009942All Organisms → Viruses → Predicted Viral4872Open in IMG/M
3300020381|Ga0211476_10016845All Organisms → Viruses → Predicted Viral3482Open in IMG/M
3300020388|Ga0211678_10284344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium676Open in IMG/M
3300020388|Ga0211678_10370717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium573Open in IMG/M
3300020392|Ga0211666_10268399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium644Open in IMG/M
3300020392|Ga0211666_10310244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium590Open in IMG/M
3300020393|Ga0211618_10069886All Organisms → Viruses → Predicted Viral1302Open in IMG/M
3300020396|Ga0211687_10312151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium618Open in IMG/M
3300020402|Ga0211499_10028190All Organisms → Viruses → Predicted Viral2314Open in IMG/M
3300020403|Ga0211532_10166757All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium895Open in IMG/M
3300020404|Ga0211659_10077917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1544Open in IMG/M
3300020404|Ga0211659_10126259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1169Open in IMG/M
3300020405|Ga0211496_10212481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium718Open in IMG/M
3300020408|Ga0211651_10196255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium788Open in IMG/M
3300020410|Ga0211699_10014080All Organisms → Viruses → Predicted Viral3182Open in IMG/M
3300020410|Ga0211699_10044539All Organisms → Viruses → Predicted Viral1658Open in IMG/M
3300020410|Ga0211699_10075482All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300020410|Ga0211699_10371536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium564Open in IMG/M
3300020411|Ga0211587_10028850All Organisms → Viruses → Predicted Viral2673Open in IMG/M
3300020411|Ga0211587_10048942All Organisms → Viruses → Predicted Viral1937Open in IMG/M
3300020411|Ga0211587_10256341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium724Open in IMG/M
3300020413|Ga0211516_10035754All Organisms → Viruses → Predicted Viral2598Open in IMG/M
3300020414|Ga0211523_10061968All Organisms → Viruses → Predicted Viral1598Open in IMG/M
3300020416|Ga0211644_10078175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1340Open in IMG/M
3300020416|Ga0211644_10316433All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium643Open in IMG/M
3300020421|Ga0211653_10462100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium543Open in IMG/M
3300020424|Ga0211620_10359055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium619Open in IMG/M
3300020429|Ga0211581_10233302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium747Open in IMG/M
3300020431|Ga0211554_10252509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium838Open in IMG/M
3300020436|Ga0211708_10033422All Organisms → Viruses → Predicted Viral1963Open in IMG/M
3300020436|Ga0211708_10085222All Organisms → Viruses → Predicted Viral1230Open in IMG/M
3300020436|Ga0211708_10173935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium861Open in IMG/M
3300020437|Ga0211539_10047225All Organisms → Viruses → Predicted Viral1693Open in IMG/M
3300020438|Ga0211576_10224378All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium994Open in IMG/M
3300020438|Ga0211576_10368299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium738Open in IMG/M
3300020438|Ga0211576_10625392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium534Open in IMG/M
3300020439|Ga0211558_10038134All Organisms → Viruses → Predicted Viral2424Open in IMG/M
3300020439|Ga0211558_10060434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1879Open in IMG/M
3300020439|Ga0211558_10355170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium682Open in IMG/M
3300020439|Ga0211558_10384036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium651Open in IMG/M
3300020439|Ga0211558_10505201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium551Open in IMG/M
3300020440|Ga0211518_10523286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium532Open in IMG/M
3300020441|Ga0211695_10038070All Organisms → Viruses → Predicted Viral1532Open in IMG/M
3300020442|Ga0211559_10160395All Organisms → Viruses → Predicted Viral1070Open in IMG/M
3300020442|Ga0211559_10197068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium952Open in IMG/M
3300020442|Ga0211559_10242569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium846Open in IMG/M
3300020445|Ga0211564_10456014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium627Open in IMG/M
3300020446|Ga0211574_10036054All Organisms → Viruses → Predicted Viral2269Open in IMG/M
3300020446|Ga0211574_10071106All Organisms → Viruses → Predicted Viral1548Open in IMG/M
3300020450|Ga0211641_10061896All Organisms → Viruses → Predicted Viral1953Open in IMG/M
3300020451|Ga0211473_10002615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium9010Open in IMG/M
3300020451|Ga0211473_10029605All Organisms → Viruses → Predicted Viral2710Open in IMG/M
3300020452|Ga0211545_10107022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1315Open in IMG/M
3300020452|Ga0211545_10257073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium802Open in IMG/M
3300020453|Ga0211550_10595392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium517Open in IMG/M
3300020454|Ga0211548_10264729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium837Open in IMG/M
3300020457|Ga0211643_10093306All Organisms → Viruses → Predicted Viral1485Open in IMG/M
3300020457|Ga0211643_10621546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium529Open in IMG/M
3300020460|Ga0211486_10457291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium545Open in IMG/M
3300020462|Ga0211546_10349423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium741Open in IMG/M
3300020463|Ga0211676_10023361All Organisms → Viruses → Predicted Viral4849Open in IMG/M
3300020467|Ga0211713_10256443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium842Open in IMG/M
3300020468|Ga0211475_10183747All Organisms → Viruses → Predicted Viral1055Open in IMG/M
3300020469|Ga0211577_10820651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium534Open in IMG/M
3300020470|Ga0211543_10019931All Organisms → Viruses → Predicted Viral3773Open in IMG/M
3300020470|Ga0211543_10021518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3610Open in IMG/M
3300020471|Ga0211614_10038071All Organisms → Viruses → Predicted Viral2005Open in IMG/M
3300020471|Ga0211614_10061707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1570Open in IMG/M
3300020471|Ga0211614_10073669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1435Open in IMG/M
3300020471|Ga0211614_10177664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium919Open in IMG/M
3300020471|Ga0211614_10237680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium793Open in IMG/M
3300020471|Ga0211614_10249363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium774Open in IMG/M
3300020473|Ga0211625_10334623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium770Open in IMG/M
3300020475|Ga0211541_10065604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1806Open in IMG/M
3300020475|Ga0211541_10233716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium901Open in IMG/M
3300020477|Ga0211585_10011815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7925Open in IMG/M
3300020478|Ga0211503_10010814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium6469Open in IMG/M
3300020478|Ga0211503_10068419All Organisms → Viruses → Predicted Viral2156Open in IMG/M
3300020595|Ga0206126_10139911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1161Open in IMG/M
3300021068|Ga0206684_1016580All Organisms → Viruses → Predicted Viral2638Open in IMG/M
3300021084|Ga0206678_10089883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1601Open in IMG/M
3300021087|Ga0206683_10054264All Organisms → Viruses → Predicted Viral2261Open in IMG/M
3300021185|Ga0206682_10273496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium743Open in IMG/M
3300021347|Ga0213862_10178276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium748Open in IMG/M
3300021352|Ga0206680_10098490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1127Open in IMG/M
3300021353|Ga0206693_1275118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium828Open in IMG/M
3300021356|Ga0213858_10142058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1172Open in IMG/M
3300021356|Ga0213858_10531541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium540Open in IMG/M
3300021364|Ga0213859_10343330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium669Open in IMG/M
3300021371|Ga0213863_10103806All Organisms → Viruses → Predicted Viral1356Open in IMG/M
3300021378|Ga0213861_10105953All Organisms → Viruses → Predicted Viral1666Open in IMG/M
3300021379|Ga0213864_10164103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1124Open in IMG/M
3300021379|Ga0213864_10468439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium632Open in IMG/M
3300021389|Ga0213868_10117132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1692Open in IMG/M
3300021389|Ga0213868_10621096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium562Open in IMG/M
3300021791|Ga0226832_10460441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium543Open in IMG/M
3300021957|Ga0222717_10007383All Organisms → cellular organisms → Bacteria7805Open in IMG/M
3300021957|Ga0222717_10017605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium4830Open in IMG/M
3300021957|Ga0222717_10024956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3980Open in IMG/M
3300021957|Ga0222717_10038142All Organisms → Viruses → Predicted Viral3153Open in IMG/M
3300021957|Ga0222717_10093063All Organisms → Viruses → Predicted Viral1890Open in IMG/M
3300021957|Ga0222717_10096314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1853Open in IMG/M
3300021957|Ga0222717_10135911All Organisms → Viruses → Predicted Viral1509Open in IMG/M
3300021958|Ga0222718_10008904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7687Open in IMG/M
3300021958|Ga0222718_10011260All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium6628Open in IMG/M
3300021958|Ga0222718_10033699All Organisms → Viruses → Predicted Viral3399Open in IMG/M
3300021961|Ga0222714_10081658All Organisms → Viruses → Predicted Viral2105Open in IMG/M
3300022063|Ga0212029_1005779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1384Open in IMG/M
3300022068|Ga0212021_1087690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium638Open in IMG/M
3300022072|Ga0196889_1085071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium586Open in IMG/M
3300022074|Ga0224906_1021060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2336Open in IMG/M
3300022140|Ga0196885_100931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium829Open in IMG/M
3300022149|Ga0196907_105302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium668Open in IMG/M
3300022183|Ga0196891_1001098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium6015Open in IMG/M
3300022308|Ga0224504_10053676All Organisms → Viruses → Predicted Viral1603Open in IMG/M
(restricted) 3300022916|Ga0233431_1171271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium880Open in IMG/M
3300023084|Ga0255778_10493366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300023105|Ga0255782_10379967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium637Open in IMG/M
3300023108|Ga0255784_10453990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium596Open in IMG/M
3300023110|Ga0255743_10505610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium571Open in IMG/M
3300023119|Ga0255762_10198120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1113Open in IMG/M
3300023173|Ga0255776_10496112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium624Open in IMG/M
3300023180|Ga0255768_10010137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium8550Open in IMG/M
(restricted) 3300024255|Ga0233438_10284193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium640Open in IMG/M
(restricted) 3300024255|Ga0233438_10347518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium554Open in IMG/M
(restricted) 3300024258|Ga0233440_1184404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium594Open in IMG/M
3300024344|Ga0209992_10026956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2982Open in IMG/M
3300024344|Ga0209992_10128142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1118Open in IMG/M
3300024344|Ga0209992_10359128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium583Open in IMG/M
3300025079|Ga0207890_1063322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium603Open in IMG/M
3300025084|Ga0208298_1051958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium800Open in IMG/M
3300025085|Ga0208792_1048614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium800Open in IMG/M
3300025086|Ga0208157_1010967All Organisms → Viruses → Predicted Viral3002Open in IMG/M
3300025086|Ga0208157_1011552All Organisms → Viruses → Predicted Viral2905Open in IMG/M
3300025086|Ga0208157_1014270All Organisms → Viruses → Predicted Viral2543Open in IMG/M
3300025086|Ga0208157_1067442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium920Open in IMG/M
3300025086|Ga0208157_1091177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium745Open in IMG/M
3300025098|Ga0208434_1026112All Organisms → Viruses → Predicted Viral1411Open in IMG/M
3300025099|Ga0208669_1017513All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300025101|Ga0208159_1004134All Organisms → Viruses → Predicted Viral4656Open in IMG/M
3300025102|Ga0208666_1023880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1909Open in IMG/M
3300025102|Ga0208666_1024395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1886Open in IMG/M
3300025110|Ga0208158_1039748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1180Open in IMG/M
3300025110|Ga0208158_1120480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium609Open in IMG/M
3300025118|Ga0208790_1013868All Organisms → Viruses → Predicted Viral2852Open in IMG/M
3300025120|Ga0209535_1040170All Organisms → Viruses → Predicted Viral2100Open in IMG/M
3300025120|Ga0209535_1041927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2037Open in IMG/M
3300025120|Ga0209535_1190318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium591Open in IMG/M
3300025120|Ga0209535_1217831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium517Open in IMG/M
3300025125|Ga0209644_1052406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium934Open in IMG/M
3300025127|Ga0209348_1023476All Organisms → Viruses → Predicted Viral2280Open in IMG/M
3300025127|Ga0209348_1027866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2049Open in IMG/M
3300025127|Ga0209348_1051952All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300025127|Ga0209348_1053552All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300025127|Ga0209348_1091496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium957Open in IMG/M
3300025127|Ga0209348_1163491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium646Open in IMG/M
3300025127|Ga0209348_1166491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium638Open in IMG/M
3300025127|Ga0209348_1212817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium533Open in IMG/M
3300025127|Ga0209348_1221974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium516Open in IMG/M
3300025128|Ga0208919_1007304All Organisms → Viruses → Predicted Viral4750Open in IMG/M
3300025128|Ga0208919_1072887All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300025131|Ga0209128_1046900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1612Open in IMG/M
3300025131|Ga0209128_1118742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium828Open in IMG/M
3300025132|Ga0209232_1014195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3212Open in IMG/M
3300025132|Ga0209232_1091401All Organisms → Viruses → Predicted Viral1039Open in IMG/M
3300025132|Ga0209232_1139391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium784Open in IMG/M
3300025133|Ga0208299_1005464All Organisms → cellular organisms → Bacteria7243Open in IMG/M
3300025137|Ga0209336_10012011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3371Open in IMG/M
3300025137|Ga0209336_10176429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium544Open in IMG/M
3300025138|Ga0209634_1237391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium669Open in IMG/M
3300025141|Ga0209756_1050452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2038Open in IMG/M
3300025151|Ga0209645_1003053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7777Open in IMG/M
3300025151|Ga0209645_1026939All Organisms → Viruses → Predicted Viral2141Open in IMG/M
3300025151|Ga0209645_1033829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1866Open in IMG/M
3300025151|Ga0209645_1067459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1215Open in IMG/M
3300025151|Ga0209645_1086470All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1036Open in IMG/M
3300025151|Ga0209645_1159026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium691Open in IMG/M
3300025151|Ga0209645_1204752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300025151|Ga0209645_1223199All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium542Open in IMG/M
3300025151|Ga0209645_1237717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium516Open in IMG/M
3300025168|Ga0209337_1002935All Organisms → cellular organisms → Bacteria12113Open in IMG/M
3300025168|Ga0209337_1006623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7767Open in IMG/M
3300025168|Ga0209337_1016827All Organisms → Viruses → Predicted Viral4381Open in IMG/M
3300025508|Ga0208148_1032189All Organisms → Viruses → Predicted Viral1401Open in IMG/M
3300025570|Ga0208660_1051997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1019Open in IMG/M
3300025577|Ga0209304_1058084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium988Open in IMG/M
3300025584|Ga0209774_1124710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium584Open in IMG/M
3300025620|Ga0209405_1093237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium882Open in IMG/M
3300025626|Ga0209716_1086246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium924Open in IMG/M
3300025630|Ga0208004_1126233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300025632|Ga0209194_1006546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5034Open in IMG/M
3300025632|Ga0209194_1156073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium534Open in IMG/M
3300025640|Ga0209198_1149029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium652Open in IMG/M
3300025645|Ga0208643_1012837All Organisms → Viruses → Predicted Viral3134Open in IMG/M
3300025652|Ga0208134_1018725All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2641Open in IMG/M
3300025654|Ga0209196_1040423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1628Open in IMG/M
3300025674|Ga0208162_1018853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2698Open in IMG/M
3300025676|Ga0209657_1153361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium647Open in IMG/M
3300025680|Ga0209306_1063649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1154Open in IMG/M
3300025699|Ga0209715_1099346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1079Open in IMG/M
3300025699|Ga0209715_1237457All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium544Open in IMG/M
3300025712|Ga0209305_1005085All Organisms → cellular organisms → Bacteria6620Open in IMG/M
3300025712|Ga0209305_1016079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3057Open in IMG/M
3300025712|Ga0209305_1070649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1164Open in IMG/M
3300025759|Ga0208899_1011919All Organisms → Viruses → Predicted Viral4758Open in IMG/M
3300025759|Ga0208899_1015766All Organisms → Viruses → Predicted Viral3957Open in IMG/M
3300025759|Ga0208899_1048529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1833Open in IMG/M
3300025771|Ga0208427_1085379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1110Open in IMG/M
3300025803|Ga0208425_1004930All Organisms → Viruses → Predicted Viral3922Open in IMG/M
3300025803|Ga0208425_1054068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium995Open in IMG/M
3300025803|Ga0208425_1087599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium737Open in IMG/M
3300025806|Ga0208545_1066335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1020Open in IMG/M
3300025815|Ga0208785_1050117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1172Open in IMG/M
3300025816|Ga0209193_1133656All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium589Open in IMG/M
3300025818|Ga0208542_1066860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1086Open in IMG/M
3300025821|Ga0209600_1002235All Organisms → cellular organisms → Bacteria11464Open in IMG/M
3300025828|Ga0208547_1004062All Organisms → cellular organisms → Bacteria7512Open in IMG/M
3300025830|Ga0209832_1172588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium623Open in IMG/M
3300025840|Ga0208917_1013391All Organisms → Viruses → Predicted Viral3592Open in IMG/M
3300025869|Ga0209308_10130872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1175Open in IMG/M
3300025873|Ga0209757_10045051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1287Open in IMG/M
3300025873|Ga0209757_10057684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1147Open in IMG/M
3300025876|Ga0209223_10410857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium575Open in IMG/M
3300025881|Ga0209309_10025179All Organisms → Viruses → Predicted Viral3901Open in IMG/M
3300025886|Ga0209632_10254902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium896Open in IMG/M
3300025886|Ga0209632_10560667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium510Open in IMG/M
3300025889|Ga0208644_1211695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium832Open in IMG/M
3300025890|Ga0209631_10552973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium500Open in IMG/M
3300026115|Ga0208560_1026332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium559Open in IMG/M
3300026130|Ga0209961_1066642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium664Open in IMG/M
3300026138|Ga0209951_1031910All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1157Open in IMG/M
3300026138|Ga0209951_1037082All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1063Open in IMG/M
3300026187|Ga0209929_1024134All Organisms → Viruses → Predicted Viral1871Open in IMG/M
3300026203|Ga0207985_1138641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium557Open in IMG/M
3300026253|Ga0208879_1138904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium996Open in IMG/M
3300026257|Ga0208407_1099587All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium920Open in IMG/M
3300026270|Ga0207993_1024866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1841Open in IMG/M
3300026292|Ga0208277_1259464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium520Open in IMG/M
3300026465|Ga0247588_1122323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300027077|Ga0208941_1010481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1293Open in IMG/M
3300027186|Ga0208797_1018373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium947Open in IMG/M
3300027206|Ga0208023_1020052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1163Open in IMG/M
3300027522|Ga0209384_1002108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium9588Open in IMG/M
3300027522|Ga0209384_1008083All Organisms → Viruses → Predicted Viral3946Open in IMG/M
3300027522|Ga0209384_1147478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium517Open in IMG/M
3300027702|Ga0209036_1059388All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300027704|Ga0209816_1010992All Organisms → cellular organisms → Bacteria5283Open in IMG/M
3300027704|Ga0209816_1058354All Organisms → Viruses → Predicted Viral1689Open in IMG/M
3300027714|Ga0209815_1027077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2291Open in IMG/M
3300027774|Ga0209433_10231265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium695Open in IMG/M
3300027779|Ga0209709_10000126Not Available70695Open in IMG/M
3300027788|Ga0209711_10051291All Organisms → Viruses → Predicted Viral2270Open in IMG/M
3300027801|Ga0209091_10039981All Organisms → Viruses → Predicted Viral2791Open in IMG/M
3300027838|Ga0209089_10018734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium4933Open in IMG/M
3300027844|Ga0209501_10159647All Organisms → Viruses → Predicted Viral1486Open in IMG/M
3300027844|Ga0209501_10431794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium771Open in IMG/M
3300027906|Ga0209404_10136670All Organisms → Viruses → Predicted Viral1480Open in IMG/M
3300028125|Ga0256368_1079638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium557Open in IMG/M
3300028190|Ga0257108_1052313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1227Open in IMG/M
3300028196|Ga0257114_1008880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5443Open in IMG/M
3300028280|Ga0228646_1172058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium518Open in IMG/M
3300028297|Ga0228617_1145279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium534Open in IMG/M
3300029319|Ga0183748_1014857All Organisms → Viruses → Predicted Viral3003Open in IMG/M
3300029319|Ga0183748_1021511All Organisms → Viruses → Predicted Viral2274Open in IMG/M
3300029319|Ga0183748_1124244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium552Open in IMG/M
3300029319|Ga0183748_1134793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium511Open in IMG/M
3300029448|Ga0183755_1010747All Organisms → Viruses → Predicted Viral3602Open in IMG/M
3300029448|Ga0183755_1035323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1414Open in IMG/M
3300029448|Ga0183755_1038364All Organisms → Viruses → Predicted Viral1321Open in IMG/M
3300029787|Ga0183757_1000332All Organisms → cellular organisms → Bacteria26927Open in IMG/M
3300029787|Ga0183757_1002440All Organisms → cellular organisms → Bacteria7294Open in IMG/M
3300029792|Ga0183826_1016832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1190Open in IMG/M
3300031519|Ga0307488_10472057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium756Open in IMG/M
3300031757|Ga0315328_10068467All Organisms → Viruses → Predicted Viral2007Open in IMG/M
3300031766|Ga0315322_10457817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium842Open in IMG/M
3300031775|Ga0315326_10250415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1162Open in IMG/M
3300031785|Ga0310343_10326603All Organisms → Viruses → Predicted Viral1093Open in IMG/M
3300032011|Ga0315316_10093194All Organisms → Viruses → Predicted Viral2458Open in IMG/M
3300032011|Ga0315316_10797904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium779Open in IMG/M
3300032011|Ga0315316_11084016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium648Open in IMG/M
3300032047|Ga0315330_10038063All Organisms → Viruses → Predicted Viral3224Open in IMG/M
3300032088|Ga0315321_10578964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium668Open in IMG/M
3300032130|Ga0315333_10194359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium961Open in IMG/M
3300032130|Ga0315333_10398735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium650Open in IMG/M
3300032360|Ga0315334_10371139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1206Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.75%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.78%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.53%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater4.01%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.21%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.21%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.80%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.66%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.66%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.52%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.52%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.38%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.38%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.11%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.69%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.55%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.55%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.55%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.55%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.41%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.28%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.28%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.28%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine0.28%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.28%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.28%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.28%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.14%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.14%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.14%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.14%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.14%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.14%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.14%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.14%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment0.14%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.14%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300001942Marine microbial communities from Polynesia - GS047EnvironmentalOpen in IMG/M
3300001943Marine microbial communities from Cape May, New Jersey, USA - GS010EnvironmentalOpen in IMG/M
3300001956Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051EnvironmentalOpen in IMG/M
3300001965Marine microbial communities from Coastal Floreana, Equador - GS028EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300003474Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4EnvironmentalOpen in IMG/M
3300003476Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005514Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263EnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005611Saline surface water microbial communities from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006305Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025mEnvironmentalOpen in IMG/M
3300006308Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500mEnvironmentalOpen in IMG/M
3300006329Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500mEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006350Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075mEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007113Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-isEnvironmentalOpen in IMG/M
3300007114Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009619Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014973Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubationEnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016787Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018938Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_039 - TARA_B100000091 (ERX1399742-ERR1328124)EnvironmentalOpen in IMG/M
3300019034Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_039 - TARA_B100000091 (ERX1399743-ERR1328123)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020245Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX556111-ERR599135)EnvironmentalOpen in IMG/M
3300020247Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)EnvironmentalOpen in IMG/M
3300020255Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013)EnvironmentalOpen in IMG/M
3300020257Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048)EnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020294Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153)EnvironmentalOpen in IMG/M
3300020296Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140)EnvironmentalOpen in IMG/M
3300020297Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979)EnvironmentalOpen in IMG/M
3300020314Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974)EnvironmentalOpen in IMG/M
3300020332Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX555956-ERR598975)EnvironmentalOpen in IMG/M
3300020343Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020353Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020360Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020375Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132)EnvironmentalOpen in IMG/M
3300020376Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020393Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020402Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020405Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020411Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020416Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020429Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020460Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020467Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020473Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300020477Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021352Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021791Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmerEnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022140Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v3)EnvironmentalOpen in IMG/M
3300022149Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300023084Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023119Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaGEnvironmentalOpen in IMG/M
3300023173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024258 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025584Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025654Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026115Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026203Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes)EnvironmentalOpen in IMG/M
3300026253Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026257Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes)EnvironmentalOpen in IMG/M
3300026270Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes)EnvironmentalOpen in IMG/M
3300026292Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027077Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027206Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027702Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027774Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028190Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000mEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028297Seawater microbial communities from Monterey Bay, California, United States - 18DEnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032130Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1003041863300000101MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOSum2010_1007693413300000101MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOSum2010_1011446013300000101MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOSum2011_1003584853300000115MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOSum2011_1004932423300000115MarineMKKIIGLLLLGVLYGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL*
DelMOSum2011_1006116413300000115MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOSum2011_1010347113300000115MarineKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQIXEEXPFDRSELGGALKEAIGNAVQEIL*
DelMOWin2010_1001199053300000117MarineMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
DelMOWin2010_1002349143300000117MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOWin2010_1008868023300000117MarineMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
DelMOWin2010_1011379823300000117MarineMKKLWSIILLCGVVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
DelMOWin2010_1021392523300000117MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQIXEEXPFDRSELGGA
JGI20152J14361_1002660433300001344Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI20152J14361_1004924923300001344Pelagic MarineMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI20152J14361_1010608313300001344Pelagic MarineMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGG
JGI20152J14361_1010849013300001344Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGG
JGI20152J14361_1010929613300001344Pelagic MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAV
JGI20151J14362_1011993823300001346Pelagic MarineIGLLLLGVLYGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL*
JGI20151J14362_1012898713300001346Pelagic MarineMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPF
JGI20158J14315_1006301913300001355Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI20158J14315_1016889713300001355Pelagic MarineMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELP
JGI20158J14315_1019929613300001355Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYXLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI20158J14315_1021259913300001355Pelagic MarineMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRS
JGI24006J15134_10002444113300001450MarineMKRLLLILLIGFAQAQLPQPTLVGQEKLQVPTLSINNFVNQAEVEGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGSPRKSTTILGLFRTESKTTEVRVVVELKNKKTGNIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVQEIL*
JGI24006J15134_1003151333300001450MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI24006J15134_1022090913300001450MarineEILIIPLYLELIFKEKKMKKLWSIAILFSVVFAQLPEPTMVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEI
JGI24003J15210_1007095513300001460MarineVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
JGI24003J15210_1008476023300001460MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGA
JGI24003J15210_1017770913300001460MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQE
JGI24004J15324_1002974623300001472MarineMKKLWSVILLIGLVNAQMPEPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
GBIDBA_1001170063300001683Hydrothermal Vent PlumeMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
GOS2262_101363143300001942MarineMKKLWTIAILFSVVFAQLPEPTMVGQDKLQVPTLTINKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKDKKTGQVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
GOS2226_102827613300001943MarineMKKLWSIILLCGIVFGQLPQPTMVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEE
GOS2266_103299823300001956MarineMKKLWSVALLCSVMFAQLPQPTMVGEDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYELIEGGSPEFEMTAKVVYLGRPRKSATILGLFRRETTTTEVRVVVELRNLKTGKVVSGNGVGTIDRQISSTGFQISEDLPFDRSELGGALKEAIGNAVQEIL*
GOS2243_103408423300001965MarineMKKLWLITILSSLVFAQLPTPTMVGQDDLKVPTLSINNFVNEAEIRGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQQIL*
KVRMV2_10017824113300002231Marine SedimentMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLXRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
KVWGV2_1066277113300002242Marine SedimentMKKLWSIILLIGLVNAQMPEPTMVGQEKLQIPTLSINNFVNEAEVQGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSIGFQINEELPFDRSELGG
JGI25127J35165_101795223300002482MarineMKKLWTIAILFNVVFAQLPQPTIVGQDDLQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKEIL*
JGI25127J35165_112599213300002482MarinePTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL*
JGI25132J35274_101939723300002483MarineMKKLWSVILLIGLVNAQLPQPTLVGQDDLKVPTLSINNFVNQAEVVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELG
JGI25132J35274_102062023300002483MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKXQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
JGI25132J35274_102810723300002483MarineMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRXDLVEQDSDFXLTARVIYLGRPRTATTFLGLFXRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
JGI25132J35274_104790723300002483MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMXSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKEKKTGVVKTGNGTGTINREISSTGFQINEELPFDRSELGGALKEAIGNAVQEXL*
JGI25132J35274_106092413300002483MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGN
JGI25128J35275_103134223300002488MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL*
JGI25128J35275_104078423300002488MarineMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVKGNGTGTVDKKINARGFQIEEDLPFDRSE
JGI25128J35275_104656713300002488MarineMKRLLIILLIGFAQAQLPQPTMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVKGNGTGTVDKKINARGFQIEEDLPFDRSE
JGI25128J35275_104993323300002488MarineMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
JGI25133J35611_1008563923300002514MarineLLIGLVNAQMPEPTMVGQDELKIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
NAP4_102856023300003474EstuarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIE*LEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
NAP2_103074723300003476EstuarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
JGI26238J51125_103375323300003478MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0055584_10090235113300004097Pelagic MarineTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
Ga0073579_1189969313300005239MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066856_1017596523300005404MarineMKKLWLIVLLIGLVNAQMPTPTMVGQDELKVPTLSINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVIKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066856_1031928513300005404MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0066851_1015534413300005427MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066849_1003599543300005430MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDKLQVPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0074648_116942713300005512Saline Water And SedimentMKKLWSIVLLCGIVFGQLPQPTMVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0066866_1024490713300005514MarineWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGIVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066862_1012190623300005521MarineMKKLWLIVLLIGLVNAQMPTPTMVGQDKLQVPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066865_1013070513300005523MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0066835_1011848113300005606MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGA
Ga0074647_103348613300005611Saline Water And SedimentMKKLWSIVLLCGIVFGQLPQPTMVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILG*FRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRS
Ga0075474_1001331623300006025AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0075474_1002301823300006025AqueousMKKIWIMALLIGLVHAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075478_1011560323300006026AqueousDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0075462_1022204213300006027AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEEL
Ga0075441_1000937463300006164MarineMKKIIGLLLLGVLYGQMPQPTMIGQDFKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRTSATILGIFKKESTTTEIRVVVELINNQTGKIVSGNGVGFTKRDISATGLQINKDLPFDRSELGGALKEAIENAVKEIL*
Ga0075441_1001165123300006164MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGIGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL*
Ga0075441_1006764123300006164MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0066836_1003667143300006166MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELKIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0075446_1023614913300006190MarineLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGIGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL*
Ga0068468_102925713300006305MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQE
Ga0068470_170293823300006308MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKAKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGQVTVGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0068486_108586923300006329MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0068500_116657923300006332MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0099693_104741713300006345MarineVGQDDLQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0099693_110700213300006345MarineIGLVNAQMPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0099954_102373323300006350MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0075502_161484613300006357AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDFVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0075488_146128623300006397AqueousTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0075506_171586823300006401AqueousMKKLWSIILLCGIVFGQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0100228_102729123300006565MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0100228_102903223300006565MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVVVELKNKKTGEVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL*
Ga0100228_120560623300006565MarineQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0075461_1021509123300006637AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKE
Ga0098038_101014563300006735MarineMKRLLIILLIGFAQAQLPQPTLLGQEKLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVIVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL*
Ga0098038_102198433300006735MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098038_102312923300006735MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098038_109342023300006735MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098038_115605823300006735MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIQGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098038_123963823300006735MarineAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098037_100762573300006737MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098037_101380763300006737MarineMKRLLIILLIGFAQAQLPQPTMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL*
Ga0098037_101595543300006737MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098037_118304913300006737MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGA
Ga0098037_121102623300006737MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL*
Ga0098035_105812723300006738MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098042_100480323300006749MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098042_108032123300006749MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098042_115680813300006749MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098058_107955923300006750MarineMKKLWSIAILLSVVFAQLPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098048_108512013300006752MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098039_102096623300006753MarineMKKIIGLLLLGVLVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0098044_101862333300006754MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098044_125227713300006754MarineIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0098055_101805923300006793MarineMKKLWLIVLLMGLVNAQMPEPTMIGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0070749_1036768723300006802AqueousQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0070749_1074517623300006802AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISST
Ga0070754_1030677013300006810AqueousPQPTLVGQDDLKVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075481_1009753923300006868AqueousWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075477_1001111133300006869AqueousMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075477_1017804013300006869AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSE
Ga0075475_1000809253300006874AqueousMALLIGLVHAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0066376_1001821723300006900MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKVKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGKVTIGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0070750_1006762323300006916AqueousMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0070750_1032526513300006916AqueousMKKLWSIILLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGN
Ga0098060_118590613300006921MarineIPLYLEQTFRRQQMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098045_103378023300006922MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELG
Ga0098051_112817523300006924MarineMVGQDELKIPTLSINNFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAIDNAVQEII*
Ga0098050_103834223300006925MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVK
Ga0098050_104085723300006925MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098050_106798213300006925MarineGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0098050_108915523300006925MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAIDNAVQEII*
Ga0098041_105200723300006928MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL*
Ga0098041_107735113300006928MarineQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQISEDLPFDRSELGGALREAIDNAVQEII*
Ga0098041_117318913300006928MarineVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVIVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL*
Ga0098041_120919923300006928MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVIRSGNGVGTIDRVISTTGYGINEEQ
Ga0098041_124854023300006928MarineILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL*
Ga0098036_105568913300006929MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGA
Ga0098036_110280713300006929MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVIKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098036_112531923300006929MarineMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKATTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0075444_1033093513300006947MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGTVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098046_105530723300006990MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL*
Ga0101666_110052913300007113Volcanic Co2 Seep SeawaterMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYELIEGGSPEFEMTARVVYLGKPRKSATILGLFRRETTTTEVRVVVELKNLKTGKVVSGNGIGTIDRQISSTGFQISEDLPFDRSELGGALKEAIGNAVQEI
Ga0101668_111647713300007114Volcanic Co2 Seep SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEE
Ga0075468_1000582723300007229AqueousLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0075469_1001706523300007231AqueousLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0075460_1001246953300007234AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075460_1005525623300007234AqueousLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0070747_106304123300007276AqueousVKEILIIPLYLELIFKEKKMKKLWSIAILFSVVFAQLPEPTMVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAI
Ga0070753_100861243300007346AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNKAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0105020_103122233300007514MarineMKKIIGLLLLGILVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYELVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEDLPFDRSELGGALKEAINNAVNEIF*
Ga0099851_110792923300007538AqueousQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL*
Ga0099851_113899123300007538AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNALHNILLRNNCYTICDIVDRIYYIF
Ga0099847_100419233300007540AqueousMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL*
Ga0102861_104625323300007544EstuarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0102948_108303723300007623WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0102855_115556913300007647EstuarineQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0102951_111493513300007725WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPF
Ga0102954_105893823300007778WaterMKKLWSITILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0099850_106170033300007960AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL*
Ga0110931_106939923300007963MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL*
Ga0075480_1002738033300008012AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL*
Ga0075480_1026339423300008012AqueousPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098052_108692223300008050MarineLELIFKEKKMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0098052_109740723300008050MarineKEKKMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAIDNAVQEII*
Ga0098052_128126723300008050MarineLELIFKEIKMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINE
Ga0098052_139899613300008050MarineMKKLWSIILLIGLVNAQMPEPTMVGQDELKIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINE
Ga0114898_112475413300008216Deep OceanMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114898_121923613300008216Deep OceanVKMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKAKVVYLGRPRKSATILGIFNRESQTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0114905_125951413300008219Deep OceanLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKAKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGQVTVGQGTGFIKRDISSTGFQINEELPFNRSELGGALKEAINNAVNEIF*
Ga0102816_100699733300008999EstuarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0102960_106957713300009000Pond WaterMKKLWSITILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISS
Ga0102960_109591323300009000Pond WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLAINNFVNQAEVEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKDLL*
Ga0102960_113343113300009000Pond WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0102960_128794713300009000Pond WaterMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVAVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRS
Ga0102963_101817033300009001Pond WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0102963_121955613300009001Pond WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLAINNFVNQAEVEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL*
Ga0102963_124994923300009001Pond WaterMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVAVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAI
Ga0102810_104226823300009002EstuarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEDRVVVELKNKKTSQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0102829_114722723300009026EstuarineLLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0102957_122824513300009027Pond WaterMKKLWSITILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKEIL*
Ga0102864_114328623300009051EstuarineWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0102854_108870223300009058EstuarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115566_1028455023300009071Pelagic MarineLELIFKEIKMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115566_1083972213300009071Pelagic MarineQLPQPTLVGQDDLQVPTLAINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
Ga0115549_106300923300009074Pelagic MarineLELIFKEKKMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115549_108758813300009074Pelagic MarineMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0115550_104774213300009076Pelagic MarineLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDI
Ga0115552_140144313300009077Pelagic MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGA
Ga0102814_1074151613300009079EstuarineFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVETIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0118687_1003747413300009124SedimentMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQEIL*
Ga0118687_1012665833300009124SedimentMKKLWSIAILLSVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFD
Ga0114996_1009603513300009173MarineLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGTVVSGNGVGTIDKEISATGFQINEELPFDR
Ga0114996_1014987733300009173MarineLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0114996_1017065933300009173MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGTGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL*
Ga0115551_143211013300009193Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0114993_1049421013300009409MarineYLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEIMGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114908_116136013300009418Deep OceanMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLLRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114994_1112588613300009420MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRS
Ga0115548_108672523300009423Pelagic MarineVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114997_1010064233300009425MarineVKEILIIPLYLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGTVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115545_111365913300009433Pelagic MarineLELIFKEIKMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0115545_125031713300009433Pelagic MarineMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0115545_132772813300009433Pelagic MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEE
Ga0115562_112288523300009434Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVCLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115546_126510413300009435Pelagic MarineNEILIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115008_1008764343300009436MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115559_106276523300009438Pelagic MarineLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQ
Ga0115561_114799313300009440Pelagic MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELG
Ga0115563_109096023300009442Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115563_112956413300009442Pelagic MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEDRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEA
Ga0115557_101321293300009443Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115560_103490123300009447Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115558_101494613300009449Pelagic MarineVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115558_142013413300009449Pelagic MarineSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115558_142013513300009449Pelagic MarineSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115565_1004854233300009467Pelagic MarineMSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115565_1014669313300009467Pelagic MarineLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115554_103403613300009472Pelagic MarineLIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115554_125514113300009472Pelagic MarineLELIFKEKKMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0114932_1001249833300009481Deep SubsurfaceMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0114932_1009676523300009481Deep SubsurfaceLEQTFRRQQMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILNEYAMDSRYDLVEGGSPDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNLKTGIVVSGNGLGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL*
Ga0114932_1014543323300009481Deep SubsurfaceMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114932_1021785323300009481Deep SubsurfaceMKEILVIPLYLELTFKEKKMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
Ga0115570_1002614713300009496Pelagic MarineIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115570_1003349623300009496Pelagic MarineLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115569_1006342433300009497Pelagic MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115564_1042117013300009505Pelagic MarineTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115567_1091203713300009508Pelagic MarineIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGAL
Ga0115003_1005505033300009512MarineLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115003_1051373113300009512MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGN
Ga0115013_1037208313300009550MarineMKKLWSVILLIGLVNAQMPTPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAI
Ga0115011_1004161023300009593MarineMGLVNAQMPAPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRIFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115011_1020380223300009593MarineLELIFKEKKMKKLWLIVLLMGLVNAQMPEPTMIGQDKLKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGKVVSGNGVGTIDREISSTGFQISEDLPFDRSELGGALREAIDNAVQEII
Ga0115011_1030242813300009593MarineLYLEQTFKEIKMKKLWSVVLLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNEAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115011_1153993713300009593MarineLELIFKEIKMKKLWLIVLLIGLVNAQMPTPTMVGQDELTIPTLRINNFVNQAEVEGLEDTRIFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREI
Ga0105236_103384313300009619Marine OceanicGVKMKKIIGLLLLGVLVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKARVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF*
Ga0115104_1043844823300009677MarineLEQTFRRQQMKKLWSIAILFSVVFAQLPEPTLVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSE
Ga0115104_1053864313300009677MarineELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQ
Ga0115104_1054006423300009677MarineELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115105_1000331023300009679MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0114933_1018700613300009703Deep SubsurfaceVKEILVIPLYLELTFKEKKMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
Ga0114933_1020881923300009703Deep SubsurfaceLELIFKEIKMKKLWTIAILFNVVFAQLPQPTIVGQDDLQIPTLSINNFVNEAEVVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0114933_1037592823300009703Deep SubsurfaceLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0115000_1001208983300009705MarineVKEILIIPLYLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0115000_1081860713300009705MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATG
Ga0115002_1009138533300009706MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLQVPTLSISNFVNQAEIQGLEDSRVFLGVRQILTENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114999_1008121413300009786MarineIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGTVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0114999_1128935113300009786MarineIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNA
Ga0115012_1112520923300009790MarineLELIFKEIKMKKLWLIVLLIGLVNAQMPTPTMVGQDELKIPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQI
Ga0098043_104056413300010148MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAV
Ga0098043_104548213300010148MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVK
Ga0098043_105832223300010148MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098043_110462423300010148MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKDKKTGQVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0098043_117538923300010148MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVIVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIG
Ga0098049_103864833300010149MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098049_105208823300010149MarineLELIFKEKKMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVI
Ga0098049_108305423300010149MarineLELIFKEIKMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQI
Ga0098049_122245513300010149MarineMKKLWLIVLLMGLVNAQMPEPTMIGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAI
Ga0098056_102395233300010150MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENNSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL*
Ga0098056_102870043300010150MarineKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAIDNAVQEII*
Ga0098056_112804723300010150MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL*
Ga0098056_129960113300010150MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISS
Ga0098056_132407613300010150MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQ
Ga0098059_102829523300010153MarineLELIFKEKKMKKLWLIVLLMGLVNAQMPEPTMIGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQISEDLPFDRSELGGALREAIDNAVQEII
Ga0098047_1028554613300010155MarineKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0129324_1009976013300010368Freshwater To Marine Saline GradientMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0129324_1018164113300010368Freshwater To Marine Saline GradientMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0151669_13088213300011128MarineTAEESTRLLEFRRVRFRSGLVNAQLPEPTLVGQDKLKLPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0151674_106278323300011252MarinePTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0151674_106278433300011252MarineLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0151671_104036813300011253MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRS
Ga0151671_104036913300011253MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0151677_102020133300011258MarineMKKLWSIVILFGVVFAQLPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL*
Ga0129347_113413413300012504AqueousMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIQGLEDSRIFLGITNILAENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL*
Ga0160422_1059943013300012919SeawaterVKETLVIPLYLELIFKEMKMKKLWTIAILFSVVFAQLPEPTMVGQDKLQVPTLTINKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGQVFSGNGVGTIDREISSTG
Ga0160422_1060127123300012919SeawaterMKKLWSVVLLFGVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSATILGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISST
Ga0160422_1072027513300012919SeawaterKKMKKLWSVAILLSVVFAQLPQPTLVGQDELQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0160423_1000468473300012920Surface SeawaterMKRLLIILLIGFAQAQLPQPTIIGQDDLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL*
Ga0160423_1010869523300012920Surface SeawaterMKKLWSVVILCSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0160423_1013449943300012920Surface SeawaterLEQTFRRQQMKKLWSIAILLSVVFAQLPQPTLVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYIGRPRKATTVLGLFRRETTTTEVRVVVELKDKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0160423_1014966313300012920Surface SeawaterMKKLWSVILLIGLVNAQLPQPTLVGQDDLKVPTLSINNFVNQAEVVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTT
Ga0160423_1051598113300012920Surface SeawaterLELIFKEIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0160423_1058198023300012920Surface SeawaterEIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0160423_1065001413300012920Surface SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTT
Ga0160423_1074823513300012920Surface SeawaterMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEE
Ga0160423_1085841313300012920Surface SeawaterEIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQDLL*
Ga0160423_1110958213300012920Surface SeawaterEIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQDLL*
Ga0160423_1118300013300012920Surface SeawaterMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEE
Ga0163110_1023285033300012928Surface SeawaterMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGQVVSGNGVGTIDREISSTGFQINEELPFDRSELGG
Ga0163110_1048794813300012928Surface SeawaterMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAV
Ga0163110_1091222413300012928Surface SeawaterMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEA
Ga0163110_1107789013300012928Surface SeawaterMKKLWSIVLLLGVVFAQLPQPTMAGQDNLKVPTLSVNNFVNQAEIEGLEDSRVFLGITNILNENVMDSRYELIEGGSPDFEMTARVVYLGRPRTATTFLGLFRRETTTTEVRVVVELKNLKTGKVVSGNGTGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAV
Ga0163110_1144267113300012928Surface SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVIVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGG
Ga0163110_1150918113300012928Surface SeawaterNWYRLCNRRQIMKKLWLIAILSSLSLVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVIVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAV
Ga0163110_1161001413300012928Surface SeawaterMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGG
Ga0163110_1164769913300012928Surface SeawaterMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGG
Ga0163109_1016492333300012936Surface SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0163109_1017010733300012936Surface SeawaterMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQQIL*
Ga0163109_1018988433300012936Surface SeawaterMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0163109_1033283823300012936Surface SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYIGRPRKATTVLGLFRRETTTTEVRVVVELKDKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0163109_1105037513300012936Surface SeawaterMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQDLL*
Ga0163180_1032193713300012952SeawaterMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSEL
Ga0163179_1000724933300012953SeawaterMKKLWSVILLIGLVNAQMPEPTLVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL*
Ga0163179_1002570143300012953SeawaterMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0163179_1003699823300012953SeawaterLELIFKEIKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0163111_1048154823300012954Surface SeawaterVKETLVIPLYLELIFKEMKMKKLWTIAILFSVVFAQLPEPTMVGQDKLQVPTLTINKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKDKKTGQVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL*
Ga0163111_1121501823300012954Surface SeawaterVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL*
Ga0163111_1152224023300012954Surface SeawaterGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL*
Ga0163111_1239180013300012954Surface SeawaterEIKMKKLWLITILSSLVFAQLPQPTLVGQDDLKVPTLSINNFVNEAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGQIVSGNGTGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL*
Ga0163111_1269676813300012954Surface SeawaterMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGI
Ga0129340_115774613300012963AqueousAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL*
Ga0134293_100634023300014973MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNCVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0182076_148048413300016739Salt MarshMKKLWSIILLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0182079_139860813300016741Salt MarshDKMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0182080_152656923300016787Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0180120_1016541123300017697Freshwater To Marine Saline GradientAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181377_101939423300017706MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0181369_104356623300017708MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRS
Ga0181369_110726813300017708MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIDGLEDSRVFLGISNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTFLGLFRRETTTTEVRVVVELLNKKTGVIKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKEIL
Ga0181369_111146213300017708MarineKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVKEIL
Ga0181412_114301713300017714SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGAL
Ga0181404_102222733300017717SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAI
Ga0181390_105972623300017719SeawaterMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181383_109622713300017720SeawaterTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181383_113384823300017720SeawaterMKKLWSVILLIGLVNAQMPEPTIIGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQIN
Ga0181388_106221213300017724SeawaterILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181398_102118823300017725SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEITARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181398_108473013300017725SeawaterLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181417_116197313300017730SeawaterKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181416_117041313300017731SeawaterKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181426_102740123300017733SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGIGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181428_104491523300017738SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181428_115594723300017738SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGSSF
Ga0181428_116135113300017738SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEI
Ga0181418_114197813300017740SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181418_115031613300017740SeawaterMKKIIGLLLLGVLYGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRIENETEMGLEESGFYVIKNDGKK
Ga0181397_104950713300017744SeawaterLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181389_101903913300017746SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDRLQFPTLTINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181393_115270613300017748SeawaterIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181392_120676713300017749SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEITARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0181405_117611913300017750SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0187219_106719413300017751SeawaterVVSNLVGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0181420_113726213300017757SeawaterTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181409_110756023300017758SeawaterMKKLWLIVLLIGLVNAQMPQPTLVGQDRLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181408_115949523300017760SeawaterLVGQDRLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181422_115209023300017762SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGG
Ga0181385_118127213300017764SeawaterMKKLWSVILLIGLVNAQMPEPTIIGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0181385_124966113300017764SeawaterKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181385_127080713300017764SeawaterGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181413_114737713300017765SeawaterMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181406_100721633300017767SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGIEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0187217_107648613300017770SeawaterDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181430_104528923300017772SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181430_107041323300017772SeawaterNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181395_112348123300017779SeawaterEQRDKRVVSNLVGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0181395_121897413300017779SeawaterMKKLWSVILLIGLVNAQMPEPTLVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0181423_125010913300017781SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181380_106822713300017782SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFD
Ga0181380_116946013300017782SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFD
Ga0181565_1025768323300017818Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQEIL
Ga0181565_1065274113300017818Salt MarshMKKLWSIILLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181552_1011504123300017824Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181577_1006089533300017951Salt MarshMKKLWSIVLLCGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181583_1017083733300017952Salt MarshLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181580_1015958923300017956Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQEIL
Ga0181580_1058210913300017956Salt MarshQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181571_1073030123300017957Salt MarshPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181581_1045169823300017962Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQE
Ga0181589_1004124333300017964Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAKGNAVQEIL
Ga0181590_1008327413300017967Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLP
Ga0181590_1045876723300017967Salt MarshVFGQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181587_1066677023300017968Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEA
Ga0181585_1044329113300017969Salt MarshMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0181585_1095227813300017969Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVEQDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNA
Ga0181576_1011642723300017985Salt MarshMKKLWSIILLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181576_1015561113300017985Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELMNRKTGKIVTGNGIGTIDKVISST
Ga0181569_1005256143300017986Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQELL
Ga0181569_1014438823300017986Salt MarshMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181572_1008502233300018049Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181572_1008921923300018049Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0181572_1027251813300018049Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181572_1086258113300018049Salt MarshMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGAL
Ga0181561_1020603423300018410Salt MarshMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181559_1033052723300018415Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181558_1049225013300018417Salt MarshQLPQPTMVGQDELKIPTLSNNNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181567_1032750323300018418Salt MarshVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181567_1045738723300018418Salt MarshQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL
Ga0181567_1060627123300018418Salt MarshMKKLWSIVLLCGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181563_1013936533300018420Salt MarshMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181563_1022487223300018420Salt MarshMKKLWSIILLIGLVNAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181592_1003888233300018421Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0181592_1050738913300018421Salt MarshMKKLWSIILLCGIVFGQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQINEELPFD
Ga0181592_1080044213300018421Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEA
Ga0181592_1086465913300018421Salt MarshMKKLWSIVLLCGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181593_1101904723300018423Salt MarshVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181591_1028149223300018424Salt MarshMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181566_1009899933300018426Salt MarshMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0181566_1025155413300018426Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0181568_1039373213300018428Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIG
Ga0181564_1046905723300018876Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEA
Ga0193542_1003487313300018938MarineGLGIGYAIGDNKXKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAI
Ga0193543_1005138213300019034MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDKEISSTGFQINEELPFDRSELGGALKEAI
Ga0182068_138917123300019280Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0194029_101903723300019751FreshwaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQIKEEVPFDRSEL
Ga0194029_106780313300019751FreshwaterMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSEL
Ga0194023_111543513300019756FreshwaterMKKLWLIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0194032_101242723300019938FreshwaterMKKLWSIILLCGIVFGQLPQPTMVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0181594_1018962513300020054Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELP
Ga0206125_1000890043300020165SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206125_1001488523300020165SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206125_1008226623300020165SeawaterMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206128_101140043300020166SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGAGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206128_106797643300020166SeawaterKIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206128_109024123300020166SeawaterMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206127_103828313300020169SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSE
Ga0206127_127021613300020169SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206124_1001567533300020175SeawaterMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206124_1012961813300020175SeawaterKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206131_1021105723300020185SeawaterVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0181578_1023411523300020189Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0181570_1003707013300020207Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGN
Ga0211711_102158923300020245MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211654_1000406103300020247MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211586_100550223300020255MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211704_103651913300020257MarineLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVVVELMDKKTGRVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211648_106844523300020267MarineVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211520_105837723300020294MarineQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211474_104209223300020296MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211490_104234423300020297MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGTGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211522_103447813300020314MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211502_104033423300020332MarineMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211626_104032123300020343MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211504_100374853300020347MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211511_115155213300020349MarineSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211613_102515223300020353MarineMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211689_118370013300020358MarineGQDKLQFPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFRRETTTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211712_1002581413300020360MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211703_1007214223300020367MarineLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVASGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211477_1000977293300020374MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211477_1001151733300020374MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211477_1002601663300020374MarineKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211656_1015057513300020375MarineMKKIIGLLLLGVLVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0211682_1013094813300020376MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAI
Ga0211647_1030032613300020377MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGQVFSGNGVGTIDREISSTGFQINEELPFDRSEL
Ga0211476_1000994253300020381MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211476_1001684523300020381MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211678_1028434423300020388MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGG
Ga0211678_1037071723300020388MarineQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211666_1026839923300020392MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGIGTIDREISSTG
Ga0211666_1031024413300020392MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQE
Ga0211618_1006988623300020393MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211687_1031215123300020396MarineTLIGQDKLQFPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211499_1002819043300020402MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTRTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211532_1016675723300020403MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGN
Ga0211659_1007791733300020404MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211659_1012625913300020404MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0211496_1021248123300020405MarineIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211651_1019625513300020408MarineLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYIGRPRKATTVLGLFRRETTTTEVRVVVELKDKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211699_1001408023300020410MarineMKKLWSIVLLIGLVNAQMPEPTLVGQDNLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELRNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211699_1004453923300020410MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211699_1007548223300020410MarineMKKLWLIAILFSVAFAQLPKPTMVGQDRLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRTATTFLGLFRRETSTTEVRVVVELKNKKTGEVVSGNGVGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211699_1037153613300020410MarineMKKLWSIAILFSVVFAQLPTPTMVGQDELQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINE
Ga0211587_1002885053300020411MarineMKKLWTIAILFNVVFAQLPQPTIVGQDDLQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKSTTFLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKEIL
Ga0211587_1004894253300020411MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211587_1025634123300020411MarineLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211516_1003575433300020413MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211523_1006196823300020414MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211644_1007817523300020416MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGQVFSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211644_1031643313300020416MarineAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0211653_1046210013300020421MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGG
Ga0211620_1035905523300020424MarineIGLVNAQMPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVIVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211581_1023330223300020429MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLIEGGSPDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELINKKTGKVVSGNGTGTIDREISSTGFQISEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211554_1025250923300020431MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211708_1003342233300020436MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGISNILEENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211708_1008522223300020436MarineMKKLWSVVLLFGVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELMDKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211708_1017393523300020436MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVASGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211539_1004722533300020437MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211576_1022437833300020438MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211576_1036829923300020438MarineMKKLWLIVLLIGLVNAQMPQPTLVGQDRLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISATGFQ
Ga0211576_1062539213300020438MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211558_1003813423300020439MarineMKKLWSVVLLFGVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSATILGLFRRETSTTEVRVVVELMDKKTGRVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211558_1006043423300020439MarineMKRLLLILLIGFTQAQLPQPTMVGQEKLQVPTLTINKFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATILGLFRTESQTTEVRVVVELKNNKTGKIITGNGTGTVNKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVNQIL
Ga0211558_1035517023300020439MarineMKKLWSIILLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKTGNGTGTIDREISSTGFQINEELPFDRSEL
Ga0211558_1038403613300020439MarineMKKLWSIVLLLGVVFAQLPQPTMAGQDNLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILNENVMDSRYELIEGGSPDFEMTARVVYLGRPRTATTFLGLFRRETTTTEVRVVVELKNLKTGKVVSGNGTGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211558_1050520113300020439MarineMKRLLIILFIGLIQAQLPQPTMVGQDGLKVPTLSINNFVNQAEVEGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGSPRKSATILGIFRTESQTTEVRVVVELKNNKTGKIISGNGIGTVNKKINARGFQI
Ga0211518_1052328613300020440MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGA
Ga0211695_1003807013300020441MarinePTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELRNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211559_1016039523300020442MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDTRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211559_1019706813300020442MarineKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQDLL
Ga0211559_1024256923300020442MarineMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSE
Ga0211564_1045601413300020445MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRIFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211574_1003605423300020446MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0211574_1007110633300020446MarineMKKLWSVILLIGLVNAQMPTPTMVGQDELEVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKATTFLGLFRRETTTTEVRVVVELLNKKTGVIKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211641_1006189623300020450MarineMKKLWTIAILFSVVFAQLPEPTMVGQDKLQVPTLTINKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKDKKTGQVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211473_1000261573300020451MarineMKKLWSVILLIGLVNAQMPEPTMIGQEKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211473_1002960533300020451MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0211545_1010702233300020452MarineSVILLIGLVNAQMPEPTMIGQEKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211545_1025707323300020452MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEI
Ga0211550_1059539223300020453MarineGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211548_1026472923300020454MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211643_1009330633300020457MarineWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211643_1062154613300020457MarineIGLVNAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELIEGGSPDFEITARVVYVGRPRKSATILGLFRRETSTTEVRVVVEMKNNKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211486_1045729123300020460MarineQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGVVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211546_1034942323300020462MarineGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGIGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211676_1002336153300020463MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEDQPFDRSELGGALKEAIGNAVKEIL
Ga0211713_1025644323300020467MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILEENVMDSRYELVESDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGEVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211475_1018374713300020468MarineWSVILLIGLVNAQMPEPTMIGQEKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211577_1082065113300020469MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211543_1001993123300020470MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDELRVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLIEGGSSDFELTARVVYLGRPRTSTTILGLFRRETSTTEVRVVVELLNKKTGKVASGNGTGTIDREISSTGFQISEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211543_1002151823300020470MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGQVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211614_1003807113300020471MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGISNILEENVMDSRYELVESDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211614_1006170733300020471MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211614_1007366923300020471MarineMKKLWSVVLLFGVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211614_1017766433300020471MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTG
Ga0211614_1023768013300020471MarineQMPEPTMVGQDKLQIPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRTSTTFLGLFRRETTRTEVRVIVELKNKKTGQVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211614_1024936323300020471MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILNEYAMDSRYDLVEGGSPDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNLKTGIVVSGNGLGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211625_1033462323300020473MarineMKKLWSIAILFSVVFAQLPTPTIIGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0211541_1006560413300020475MarineVNAQMPEPTMIGQEKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0211541_1023371613300020475MarineKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211585_1001181543300020477MarineMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVESDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211503_1001081433300020478MarineMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0211503_1006841953300020478MarineLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206126_1013991123300020595SeawaterMKKLWSVILLIGLVNAQMPEPTIIGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0206684_101658023300021068SeawaterMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVDLLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206678_1008988323300021084SeawaterMKKIIGLLLLGVLVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKAKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGQVTVGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0206683_1005426433300021087SeawaterMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRVTTTTEVRVVVDLLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206682_1027349623300021185SeawaterVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213862_1017827623300021347SeawaterDKMKKLWSIILLCGIVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0206680_1009849023300021352SeawaterVLVGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0206693_127511813300021353SeawaterLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVDLLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213858_1014205823300021356SeawaterMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVKTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213858_1053154113300021356SeawaterMKKLWSIILLIGLVNAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQESDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKTGNGTGTIDREISSTGFQINEEL
Ga0213859_1034333013300021364SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSEIG
Ga0213863_1010380623300021371SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213861_1010595323300021378SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTVSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213864_1016410323300021379SeawaterMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0213864_1046843923300021379SeawaterVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213868_1011713233300021389SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213868_1062109613300021389SeawaterLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKETIGNAVQEIL
Ga0226832_1046044113300021791Hydrothermal Vent FluidsMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKDKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGN
Ga0222717_1000738363300021957Estuarine WaterMKKLWSIAILLSVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAIQEIL
Ga0222717_10017605103300021957Estuarine WaterFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0222717_1002495653300021957Estuarine WaterMKRLLIILFIGFAQAQLPQPTIIGQDDLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVTGNGTGTVDKTINARGFQIEEDLPFDRSEIGGALKEAIYNATSQIL
Ga0222717_1003814223300021957Estuarine WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLAINNFVNQAEVEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVKDLL
Ga0222717_1009306323300021957Estuarine WaterMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVAVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0222717_1009631423300021957Estuarine WaterMKRSLIILLIGFAQAQLPQPTLVGQDDLQVPTLSINNFVNQAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILGLFRRETTITEVRVVVELLNKKTGVIKSGNGVGTIERVISTTGYGINEDQPFDRSELGGALKEAIGNAVSQIL
Ga0222717_1013591123300021957Estuarine WaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0222718_1000890453300021958Estuarine WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0222718_1001126093300021958Estuarine WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAIQEIL
Ga0222718_1003369933300021958Estuarine WaterMKKLWSITILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0222714_1008165853300021961Estuarine WaterDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0212029_100577923300022063AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL
Ga0212021_108769023300022068AqueousGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0196889_108507123300022072AqueousPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0224906_102106023300022074SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0196885_10093113300022140AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNI
Ga0196907_10530213300022149AqueousMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL
Ga0196891_100109853300022183AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0224504_1005367623300022308SedimentMKKLCSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
(restricted) Ga0233431_117127123300022916SeawaterMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0255778_1049336613300023084Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVEQDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAV
Ga0255782_1037996713300023105Salt MarshDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0255784_1045399013300023108Salt MarshIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL
Ga0255743_1050561013300023110Salt MarshMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEI
Ga0255762_1019812013300023119Salt MarshWSIVLLCGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0255776_1049611213300023173Salt MarshGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0255768_1001013783300023180Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAV
(restricted) Ga0233438_1028419323300024255SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
(restricted) Ga0233438_1034751813300024255SeawaterKEILIIPLYLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNA
(restricted) Ga0233440_118440413300024258SeawaterLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209992_1002695643300024344Deep SubsurfaceMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0209992_1012814223300024344Deep SubsurfaceMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILNEYAMDSRYDLVEGGSPDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNLKTGIVVSGNGLGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0209992_1035912823300024344Deep SubsurfaceMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISS
Ga0207890_106332223300025079MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGA
Ga0208298_105195823300025084MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208792_104861423300025085MarineIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208157_101096743300025086MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0208157_101155263300025086MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208157_101427043300025086MarineSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0208157_106744223300025086MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL
Ga0208157_109117723300025086MarineMKRLLIILLIGFAQAQLPQPTMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL
Ga0208434_102611223300025098MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208669_101751343300025099MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0208159_100413423300025101MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL
Ga0208666_102388043300025102MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVIS
Ga0208666_102439533300025102MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVIS
Ga0208158_103974823300025110MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGN
Ga0208158_112048023300025110MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL
Ga0208790_101386833300025118MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209535_104017043300025120MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209535_104192723300025120MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0209535_119031813300025120MarineMKRLLIILLIGFAQAQFPQPTLVGQDKLQVPTLSINNFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSTTVLGLFRTESKTTEVRVVVELKNKKTGNIVTGNGTGTVNKKINARGFQIEEDLPF
Ga0209535_121783113300025120MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALK
Ga0209644_105240623300025125MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKARVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGKVTIGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVN
Ga0209348_102347633300025127MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0209348_102786613300025127MarineKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0209348_105195223300025127MarineMKKLWSMVLLCGIVFGQLPQPTLIGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILGLFRRETTTTEVRVVVELLNKRTGVIKSGNGVGTIERVISTTGYGINEDQPFDRSELGGALKEAIGNAVKDLL
Ga0209348_105355223300025127MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL
Ga0209348_109149623300025127MarineMKKLWSIVLLLGVVFAQLPQPTMAGQDNLKVPTLSVNNFVNQAEIEGLEDSRVFLGITNILNENVMDSRYELIEGGSPDFEMTARVVYLGRPRTATTFLGLFRRETTTTEVRVVVELKNLKTGKVVSGNGTGTIDREISSTGFQINEDLPFDRSELGGALKEAIGNAVQEIL
Ga0209348_116349123300025127MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209348_116649123300025127MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEDLPFDRSELGGALKEAIGNAVQEIL
Ga0209348_121281713300025127MarineFKEIKMKKLWTIAILFNVVFAQLPQPTIVGQDDLQIPTLSISNFVNEAEIVGLEDSRVFLGISNILTENVMDSRYELVEQDSDFEMTARIIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQQIL
Ga0209348_122197413300025127MarineMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREISSTGFQI
Ga0208919_100730433300025128MarineMKKLWSIAILLSVVFAQLPEPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0208919_107288713300025128MarineMKKLWSIAILFSVVFAQLPTPTMIGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAI
Ga0209128_104690023300025131MarineMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209128_111874213300025131MarineDKLQIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209232_101419523300025132MarineMKRLLIILLIGFAQAQLPQPTMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVKGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL
Ga0209232_109140113300025132MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQEIL
Ga0209232_113939123300025132MarineTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0208299_1005464143300025133MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGNVVSGNGVGTIDREISSTGFQINEDLPFDRSELGGALREAIDNAVQEII
Ga0209336_1001201113300025137MarineNLVGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0209336_1017642913300025137MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGA
Ga0209634_123739113300025138MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209756_105045223300025141MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELKIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209645_100305373300025151MarineMKRLLIILLIGFAQAQLPQPTIIGQDDLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVSQIL
Ga0209645_102693923300025151MarineMKKLWSVILLIGLVNAQLPQPTLVGQDDLKVPTLSINNFVNQAEVVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGKPRSSTTILGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAIQEIL
Ga0209645_103382953300025151MarineMKKLWSIAILLSVVFAQLPQPTLVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYIGRPRKATTVLGLFRRETTTTEVRVVVELKDKKTGVIRSGNGVGTIDRVISTTGYGINEEQPFDRSELGGALKEAIGNAVQEIL
Ga0209645_106745913300025151MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209645_108647023300025151MarineVLLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEVEGLDDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGTGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209645_115902613300025151MarineTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKEKKTGVVKTGNGTGTINREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0209645_120475213300025151MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRKSTTILGLFRRETSTTEVRVVVELKNKKTGKVVSGNGIGTIDKEISSTGFQLNEA
Ga0209645_122319913300025151MarineMKKLWLITILSSLVFAQLPTPTMVGQDDLKVPTLSINNFVNEAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVQDLL
Ga0209645_123771713300025151MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETSRTEVRVIVELKNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGN
Ga0209337_100293573300025168MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQFPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEGESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209337_100662323300025168MarineMKRLLLILLIGFAQAQLPQPTLVGQEKLQVPTLSINNFVNQAEVEGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGSPRKSTTILGLFRTESKTTEVRVVVELKNKKTGNIVTGNGTGTVDKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVQEIL
Ga0209337_101682773300025168MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGQVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208148_103218913300025508AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIG
Ga0208660_105199713300025570AqueousKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209304_105808423300025577Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAV
Ga0209774_112471023300025584MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRS
Ga0209405_109323723300025620Pelagic MarineKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209716_108624613300025626Pelagic MarineLLGVLYGQMPQPTMVDELKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGNSDFEMKARVVYLGRPRTSATILGLFKRESTTTEIRVVVELINKKTGKVVSGNGVGFTKRDISATGLQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0208004_112623313300025630AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIG
Ga0209194_100654613300025632Pelagic MarinePLYLELIFKEKKMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209194_115607313300025632Pelagic MarineQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209198_114902923300025640Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGN
Ga0208643_101283773300025645AqueousPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208134_101872513300025652AqueousEILIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209196_104042323300025654Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208162_101885313300025674AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAV
Ga0209657_115336113300025676MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGN
Ga0209306_106364923300025680Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVRSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209715_109934613300025699Pelagic MarineYLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEI
Ga0209715_123745713300025699Pelagic MarineKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209305_100508533300025712Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209305_101607913300025712Pelagic MarinePTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209305_107064913300025712Pelagic MarineNEILIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208899_101191963300025759AqueousMKKLWSIILLCGIVFGQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0208899_101576643300025759AqueousMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0208899_104852923300025759AqueousMKKLWSIVLLCGIVFGQLPQPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208427_108537913300025771AqueousLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0208425_100493063300025803AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTG
Ga0208425_105406813300025803AqueousMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSEL
Ga0208425_108759923300025803AqueousMKKLWSIILLCGVVFAQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTG
Ga0208545_106633513300025806AqueousNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208785_105011723300025815AqueousMKKIWIMALLIGLVHAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0209193_113365613300025816Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208542_106686023300025818AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINEDLPFDRSELGGALKEAIGNAVQDIL
Ga0209600_1002235133300025821Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208547_100406263300025828AqueousMALLIGLVHAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0209832_117258813300025830Pelagic MarineQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208917_101339173300025840AqueousIGLVHAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNKKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQDIL
Ga0209308_1013087223300025869Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQNIL
Ga0209757_1004505113300025873MarineVPTLSVSNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKARVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGKVTIGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0209757_1005768423300025873MarineMKRLLIILLIGFAQAQFPQPTMVGQEKLQVPTLSINNFVNQAEVEGLEDTRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGSPRKSTTILGLFRTESKTTEVRVVVELKNKKTGSIVTGNGTGTINKKINARGFQIEEDLPFDRSEIGGALKEAIYNAVNQIL
Ga0209223_1041085713300025876Pelagic MarineMKKLWLVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIG
Ga0209309_1002517983300025881Pelagic MarineIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209632_1025490223300025886Pelagic MarineKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209632_1056066713300025886Pelagic MarineVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208644_121169513300025889AqueousMKKLWSIVLLCGIVFGQLPQPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0209631_1055297313300025890Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIVSGNGTGTIDREISSTGF
Ga0208560_102633213300026115Marine OceanicGQDLPQAKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKARVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0209961_106664213300026130WaterMKKLWSIAILLSVVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEVEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQN
Ga0209951_103191023300026138Pond WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKE
Ga0209951_103708233300026138Pond WaterMKKLWSIAILLSVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGA
Ga0209929_102413413300026187Pond WaterMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVAVELKNKKTGVIRTGNGTGTIDREISSTGFQINEELPFDRSELGG
Ga0207985_113864113300026203MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGN
Ga0208879_113890423300026253MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKVKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGKVTIGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0208407_109958723300026257MarineMKKLWLIVLLIGLVNAQMPTPTMVGQDKLQVPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0207993_102486623300026270MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208277_125946423300026292MarinePTLTINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0247588_112232313300026465SeawaterLIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSEPGGALKEAIGNA
Ga0208941_101048113300027077MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208797_101837323300027186EstuarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208023_102005223300027206EstuarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209384_100210843300027522MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209384_100808323300027522MarineMKKIIGLLLLGVLYGQMPQPTMIGQDFKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRTSATILGIFKKESTTTEIRVVVELINNQTGKIVSGNGVGFTKRDISATGLQINKDLPFDRSELGGALKEAIENAVKEIL
Ga0209384_114747813300027522MarineIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGIGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL
Ga0209036_105938823300027702MarineMKKLWSIAILFSVVFAQLPTPTMVGQDELQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGVGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209816_101099293300027704MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209816_105835413300027704MarineDFKVPTMSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRTSATILGIFKKESTTTEIRVVVELINNQTGKIVSGNGVGFTKRDISATGLQINKDLPFDRSELGGALKEAIENAVKEIL
Ga0209815_102707723300027714MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGIGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL
Ga0209433_1023126523300027774MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKDKKTGQVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209709_1000012683300027779MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGTVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209711_1005129123300027788MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209091_1003998123300027801MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0209089_1001873483300027838MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGTGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQEIL
Ga0209501_1015964723300027844MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISATGFQINEELPFDRSELGGALKEAIGNAV
Ga0209501_1043179423300027844MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIKGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFEMKARVVYLGRPRKSATILGLFKRESTTTEVRVIVELINKKTGKVSSGNGTGFTKRDISSTGFQINEELPFDRSELGGALKEAINNAVQE
Ga0209404_1013667023300027906MarineMKKLWLIVLLMGLVNAQMPEPTMIGQDKLKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELKNKETGKVVSGNGVGTIDREISSTGFQISEDLPFDRSELGGALREAIDNAVQEII
Ga0256368_107963813300028125Sea-Ice BrineNEILIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAV
Ga0257108_105231323300028190MarineMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKARVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGKVTIGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0257114_100888093300028196MarineMKKLWSVILLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0228646_117205813300028280SeawaterMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0228617_114527913300028297SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINE
Ga0183748_101485733300029319MarineMKKLWSVALLCSVMFAQLPQPTMVGEDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYELIEGGSPEFEMTAKVVYLGRPRKSATILGLFRRETTTTEVRVVVELRNLKTGKVVSGNGIGTIDRQISSTGFQISEDLPFDRSELGGALKEAIGNAVQEIL
Ga0183748_102151153300029319MarineMKKLWSIAILFSVVFAQLPEPTMVGQDRLQVPTLSVNNFVNQAEIEGLEDSRVFLGISNILEENVMDSRYELVESDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEISSTGFQINEDLPFDRSELGGALKEAIGNAVQEI
Ga0183748_112424413300029319MarineILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGVVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0183748_113479313300029319MarineKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTRTEVRVIVELKNKKTGQVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0183755_101074763300029448MarineMKKLWSIILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0183755_103532323300029448MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYVGRPRTSTTFLGLFRRETSTTEVRVVVELKDKKTGVVRSGNGTGTIDKEISSKGFQINEDLPFDRSELGGALKEAIGNAVQTIL
Ga0183755_103836413300029448MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGVGTIDKEISSTGFQINEDLPFD
Ga0183757_1000332183300029787MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELRNKKTGQVVSGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0183757_1002440123300029787MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDKDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0183826_101683223300029792MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKDKKTGVVKTGNGIGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQELL
Ga0307488_1047205723300031519Sackhole BrineMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTIDREISATGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0315328_1006846733300031757SeawaterMKKIIGLLLLGVLYGQMPEPTLIGQDNLEVPTLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDFELKAKVVYLGRPRKSATILGIFNRESQTTEVRVVVELTNKRNGQVTVGQGTGFIKRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF
Ga0315322_1045781723300031766SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0315326_1025041513300031775SeawaterLIIPLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0310343_1032660323300031785SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKKTGNVVSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0315316_1009319413300032011SeawaterQIMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTINKEISSKGFQINEDLPFDRSELGGALKEAIGNAVKEIL
Ga0315316_1079790423300032011SeawaterTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGVGTIDRVISTTGYGINEDQPFDRSELGGALKEAIGNAVKEIL
Ga0315316_1108401613300032011SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0315330_1003806373300032047SeawaterQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0315321_1057896423300032088SeawaterMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVDLLNKKTGVVKSGNGVGTIDREISSTGFQINEELPFDRSELGGALKEAIG
Ga0315333_1019435923300032130SeawaterMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVDLLNKKTGVVKSGNGVGTIDREISS
Ga0315333_1039873513300032130SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEA
Ga0315334_1037113923300032360SeawaterKMTEGQWPSLSISNFVNQAEIEGLEDSRVFLGVRQILTENVMDSRYDLVEGDSDYELKAKVVYLGRPRKSATILGIFNRESTTTEVRVVVELINKRNGKVTTGQGTGFTQRDISSTGFQINEELPFDRSELGGALKEAINNAVNEIF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.